KEGG   Syntrophobotulus glycolicus: Sgly_2121Help
Entry
Sgly_2121         CDS       T01429                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sgly_2121
Enzymes [BR:sgy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Sgly_2121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2135043..2135645)
Genome map
AA seq 200 aa AA seqDB search
MIALLRGTVWEMDKDKLIVDVNGVGYLLNVPSGKLSSVRIGQEVVLHTYLLVREDDLSLF
GFADRQDKELFIKLLSVSGIGPKAALSILSSFSSVQIITALVQENHVMFTEISGIGSKIA
RRLTLELKEKFKDYHLEGLTGETFAGSESGPGSEPGIMEALLALGFTPGETRTAVNAVGK
LEGLTFEEQLREALRLLARA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgttgctgcgcgggacagtgtgggaaatggacaaggataagctgattgtcgat
gtcaatggtgtcggttatttattaaacgttccctccgggaaattaagcagcgtccggatc
ggccaggaggtggtccttcatacctatctgctggtcagggaagatgatctttcccttttt
ggctttgccgacagacaggataaagagctgtttattaaactgctcagtgtctccggtatt
ggccctaaagccgccctgtcgattttgtcctcattcagctcagtgcaaatcattacggcg
cttgtgcaggaaaatcatgtcatgttcacggagatttccggtatcgggagcaaaattgcc
cgccggctgaccctggagctgaaagagaagtttaaggattatcatctggagggcttaaca
ggcgaaacctttgcgggcagtgaaagcggaccaggttcggagccggggattatggaggcc
ttattggccctgggctttacgccgggtgaaaccagaaccgcggtaaatgcggtcggtaag
ctggaaggactgacctttgaggagcagctccgggaagccttgcgtcttttggccagggcc
taa

DBGET integrated database retrieval system