KEGG   Syntrophobotulus glycolicus: Sgly_2121Help
Entry
Sgly_2121         CDS       T01429                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sgy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2135043..2135645)
Genome map
AA seq 200 aa AA seqDB search
MIALLRGTVWEMDKDKLIVDVNGVGYLLNVPSGKLSSVRIGQEVVLHTYLLVREDDLSLF
GFADRQDKELFIKLLSVSGIGPKAALSILSSFSSVQIITALVQENHVMFTEISGIGSKIA
RRLTLELKEKFKDYHLEGLTGETFAGSESGPGSEPGIMEALLALGFTPGETRTAVNAVGK
LEGLTFEEQLREALRLLARA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgttgctgcgcgggacagtgtgggaaatggacaaggataagctgattgtcgat
gtcaatggtgtcggttatttattaaacgttccctccgggaaattaagcagcgtccggatc
ggccaggaggtggtccttcatacctatctgctggtcagggaagatgatctttcccttttt
ggctttgccgacagacaggataaagagctgtttattaaactgctcagtgtctccggtatt
ggccctaaagccgccctgtcgattttgtcctcattcagctcagtgcaaatcattacggcg
cttgtgcaggaaaatcatgtcatgttcacggagatttccggtatcgggagcaaaattgcc
cgccggctgaccctggagctgaaagagaagtttaaggattatcatctggagggcttaaca
ggcgaaacctttgcgggcagtgaaagcggaccaggttcggagccggggattatggaggcc
ttattggccctgggctttacgccgggtgaaaccagaaccgcggtaaatgcggtcggtaag
ctggaaggactgacctttgaggagcagctccgggaagccttgcgtcttttggccagggcc
taa

DBGET integrated database retrieval system