KEGG   Syntrophobotulus glycolicus: Sgly_2869Help
Entry
Sgly_2869         CDS       T01429                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
sgy00260  Glycine, serine and threonine metabolism
sgy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sgy01100  Metabolic pathways
sgy01110  Biosynthesis of secondary metabolites
sgy01130  Biosynthesis of antibiotics
sgy01230  Biosynthesis of amino acids
Module
sgy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sgly_2869
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sgly_2869
Enzymes [BR:sgy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sgly_2869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADY57138
UniProt: F0SZ20
Position
complement(2908772..2909578)
Genome map
AA seq 268 aa AA seqDB search
MSAEQNRIDEMFARRADQKKKALITFVTAGDPDLETTRKLVLEMEKAGADLVELGVPFSD
PVAEGPVIEEANLRALKNDVGIDRLFELAARLRQETNIPLVFLLYVNCVLQYGKEKFMDN
CVQSGIDGLIVPDLPDEESNEIYGENIRTGVRLIRMVAPSSDDRIETIAAKAEGFLYCVS
SLGVTGVRSGFKTDFEGFFGKINQYKSAPSAVGFGIATPEQVRDLKKYCDGVIVGSAIVK
KVAAAAGPEEAVASVGELVRSLRRALDE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgagcaaaacagaattgacgaaatgtttgcccgccgggcagatcaaaagaaa
aaagccttgattacctttgtgacggcaggagaccctgatctggaaaccacacgcaaactg
gtattggagatggaaaaggccggcgccgacctggtcgagctgggggtgccgttctccgat
ccggttgccgagggtccggtaattgaggaagccaatctgcgcgcgctcaaaaatgatgtc
ggtatagacaggctgtttgagcttgcggcccggctccggcaggagacaaatattcccctg
gtctttttgctttatgtcaattgtgttctgcaatacggcaaagaaaagtttatggacaac
tgtgtccaaagcggaatagacggtctgattgttcctgatctccctgatgaggaaagcaac
gagatttacggggagaatatccggacaggggtaagactgatccggatggtggccccctct
tcagatgaccggatcgaaaccatagccgctaaagcggaagggttcctttactgtgtttcc
tcactgggcgtgaccggagtgcgttccgggtttaaaaccgattttgaggggttctttggt
aagatcaatcaatataagagtgctccttccgcggtcggatttgggatcgccaccccggag
caggtgcgggacctgaaaaagtattgtgacggagtcattgtcggcagtgcgattgttaaa
aaagtggcggcagcggccggtccggaagaggcggtggcttcagtcggggagcttgtgcgg
agtctgcgccgggctttggacgaataa

DBGET integrated database retrieval system