KEGG   Syntrophobotulus glycolicus: Sgly_2869Help
Entry
Sgly_2869         CDS       T01429                                 

Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sgly_2869
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sgly_2869
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sgly_2869
Enzymes [BR:sgy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sgly_2869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2908772..2909578)
Genome map
AA seq 268 aa AA seqDB search
MSAEQNRIDEMFARRADQKKKALITFVTAGDPDLETTRKLVLEMEKAGADLVELGVPFSD
PVAEGPVIEEANLRALKNDVGIDRLFELAARLRQETNIPLVFLLYVNCVLQYGKEKFMDN
CVQSGIDGLIVPDLPDEESNEIYGENIRTGVRLIRMVAPSSDDRIETIAAKAEGFLYCVS
SLGVTGVRSGFKTDFEGFFGKINQYKSAPSAVGFGIATPEQVRDLKKYCDGVIVGSAIVK
KVAAAAGPEEAVASVGELVRSLRRALDE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgagcaaaacagaattgacgaaatgtttgcccgccgggcagatcaaaagaaa
aaagccttgattacctttgtgacggcaggagaccctgatctggaaaccacacgcaaactg
gtattggagatggaaaaggccggcgccgacctggtcgagctgggggtgccgttctccgat
ccggttgccgagggtccggtaattgaggaagccaatctgcgcgcgctcaaaaatgatgtc
ggtatagacaggctgtttgagcttgcggcccggctccggcaggagacaaatattcccctg
gtctttttgctttatgtcaattgtgttctgcaatacggcaaagaaaagtttatggacaac
tgtgtccaaagcggaatagacggtctgattgttcctgatctccctgatgaggaaagcaac
gagatttacggggagaatatccggacaggggtaagactgatccggatggtggccccctct
tcagatgaccggatcgaaaccatagccgctaaagcggaagggttcctttactgtgtttcc
tcactgggcgtgaccggagtgcgttccgggtttaaaaccgattttgaggggttctttggt
aagatcaatcaatataagagtgctccttccgcggtcggatttgggatcgccaccccggag
caggtgcgggacctgaaaaagtattgtgacggagtcattgtcggcagtgcgattgttaaa
aaagtggcggcagcggccggtccggaagaggcggtggcttcagtcggggagcttgtgcgg
agtctgcgccgggctttggacgaataa

DBGET integrated database retrieval system