KEGG   Syntrophobotulus glycolicus: Sgly_2888Help
Entry
Sgly_2888         CDS       T01429                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sgly_2888
Enzymes [BR:sgy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Sgly_2888
Exosome [BR:sgy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sgly_2888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2928685..2929668)
Genome map
AA seq 327 aa AA seqDB search
MEITIRPRRLRTDPVRRALVRETRINKSALILPLFIREGKGIQEDIPSLEGQKRYSPDLL
PYALETVIKAGIKNILLFGIPLTKDGVGSGAYAENGVVQQAVRAAKKNFPEISVITDVCL
CEYTDHGHCGLLKGDTVDNDATLPLLAQTALSHVEAGADIVAPSDMMDGRVNVIRQVLDR
AGFTDKAIMSYAVKYASAFYGPFREAAGSAPAFGDRKSYQMDYHNGREAVKEAGLDIAEG
ADILMVKPALSYLDVVSDLKARFHLPLAAYSVSGEYAMIKAAARAGLIDEAAMVCETAAS
VFRAGADILITYYALEIAQFIDEGRIG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcacgataaggccgagaaggctgcgcacggatcctgtcaggagagctctggtc
agggaaacccggatcaataaaagtgccttgatcctgcctctttttatccgggaaggaaaa
ggaatccaagaagatatcccttccctggaagggcaaaaacggtatagcccggacctgctt
ccttatgcgctggagaccgtgataaaggctggaatcaaaaatatcctgcttttcgggatc
cccttgaccaaagacggcgtcggaagcggcgcttatgccgaaaacggggttgttcagcaa
gcggtgcgggccgcgaaaaaaaacttccccgagatcagtgtgatcaccgatgtctgtctt
tgcgaatatacggaccatgggcactgcgggctgctcaaaggggatacggtggataatgac
gccacccttcctttacttgcccaaacagccctgtctcatgtagaggccggagcggacatt
gtcgccccgtcggatatgatggacgggcgggttaacgtaatcagacaggtcttggacaga
gcggggtttaccgataaagccatcatgtcttacgcggtgaagtacgcttccgcattttat
ggtcctttccgggaagcggccggatcagctccggctttcggggacagaaagagctatcag
atggactaccacaatgggagagaggcagtgaaggaggccggtctggatattgcggaagga
gcagatatcctgatggtcaaaccggcgctgtcctatctggacgttgtttccgacctgaaa
gcccggtttcacctgcctctggccgcttatagcgtaagcggcgaatatgccatgatcaag
gcggctgcccgggcggggttgatcgatgaggcggccatggtctgtgaaacggcggccagt
gtgttccgggcgggggcggatatcctgattacctattatgctttggagattgcccaattt
atcgatgaaggaaggataggctga

DBGET integrated database retrieval system