KEGG   Syntrophobotulus glycolicus: Sgly_3021Help
Entry
Sgly_3021         CDS       T01429                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sgly_3021
   00052 Galactose metabolism
    Sgly_3021
   00500 Starch and sucrose metabolism
    Sgly_3021
   00520 Amino sugar and nucleotide sugar metabolism
    Sgly_3021
Enzymes [BR:sgy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sgly_3021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3070702..3071607)
Genome map
AA seq 301 aa AA seqDB search
MTVIKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVQSGIEDVIIVTGRN
KRAIEDHFDRSVELEVFLEKGQKENLLHMVKDIADMVDIHYVRQKEALGLGHAIYSARKF
IGHEPFAVLLGDDVISSEVPCLKQMIKYYEKWQGNMIGVQEIPVEEVSKYGVIEGSKVSA
RLFKAENMIEKPSPAQAPKTPLAIMGRYILEPEIFDCLADLPPGRGGEIQLTDALLELSK
TQEVFAYQFIGKRYDVGDKFGFVRATIEFALAHHEIGENVIGYLRELINRYDEQQKGLRL
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgactgtaatcaaaaaagcggtaatcccggcagccggtttgggaaccagatttcttccc
gccaccaaggctcagcccaaagaaatgctgcctattgtggataaaccgaccattcagtat
attattgaagaagccgttcaatccggaatcgaggatgtcattatcgtaacaggccggaat
aagcgcgcgatcgaagatcattttgacaggtctgtagaattggaagtatttcttgaaaaa
ggccaaaaagaaaacctgctgcatatggtgaaagatatcgccgatatggttgatattcac
tatgtccgccagaaagaagcccttgggctgggccatgcgatctacagtgcccgcaagttt
atcggtcatgaaccttttgccgtcctgttgggggatgatgtcatttcttcggaagtcccc
tgtctgaaacaaatgatcaaatattatgaaaaatggcaggggaatatgatcggtgtacag
gaaataccggtggaggaagtatccaagtatggtgtaattgaaggaagcaaggtgtcggcg
aggctgtttaaagccgagaatatgatcgaaaagccaagtcccgcccaggcccccaaaacc
cctcttgcgatcatgggaagatatattcttgagccggaaatatttgactgcctggctgat
cttcctccgggaaggggaggagagatccagctgacagatgccctgctggagctaagcaaa
actcaggaggtttttgcttatcaatttatcggcaagcgatacgatgtcggggataaattt
ggttttgtcagggcgacaatcgaatttgccttagcgcatcatgagataggagaaaatgtc
atcggctatttaagagagcttatcaaccggtacgatgagcagcaaaaaggcctcaggctt
gtctga

DBGET integrated database retrieval system