KEGG   Syntrophobotulus glycolicus: Sgly_3112Help
Entry
Sgly_3112         CDS       T01429                                 

Definition
uroporphyrinogen-III C-methyltransferase; uroporphyrinogen-III synthase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sgy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3162009..3163520)
Genome map
AA seq 503 aa AA seqDB search
MKKGYVYLVGAGPGNPKLITIKGLECIAKADVLIYDRLISAHLLNQAKPECEKIYVGKSP
KAQVRTQEEINALLVEKGLAGKTVTRLKGGDPFVFGRGGEEAEALAEAGIPFEIVPGVTS
AVAVPAYAGIPVTHRGLTSSFTVITGHERADKENSNIPWKNLAEAQNTLIFLMGMENLEL
ICGKLLEHGRSAKTPVGIIEWGTYSKQRVISGELGGIASIARAKRLENPAVIVVGEVVSL
REKLNWLERRPLFGQTIIVTRASHQAAGLSQAIEELGGEALEFPVIKITEPADSQLLLRA
MENLDSLSWLIFTSVNGVEAFFAELGRRGKDIRELAGVKIAAIGPVTQAALTKRGLSVSF
VPEEFRNEKIAEGLAGKLIPGERVLLARAQEASGLLPQALAASGADVWDVPVYRTVPGEA
DKDRLRDLLENKEIDGVTFTSPSTVSHFLRLLDGKKDLLSKVKLCSIGPVTSAALQEMGL
PVFSEAKEYTVEGLVKAMIQGPA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggatatgtttatcttgtcggcgccggaccgggcaatccgaaattgatcacc
ataaagggcttggaatgtatagccaaagcggatgttctgatttatgaccgcctgatctcc
gctcatctgctcaatcaagccaagcctgagtgtgagaaaatatatgtaggtaaatcacca
aaagctcaggtaaggactcaggaagaaatcaatgccttgctggtcgaaaaagggctcgca
ggcaagacggtaaccaggcttaaaggaggagacccttttgtgttcggacgcgggggagaa
gaagcggaagctttagctgaagcagggattccctttgaaattgttcccggtgtcacttca
gcggttgccgtaccggcctatgccgggattcccgttacccatcgcggcctcacttcctcc
tttaccgtaattacaggccatgagagagcggataaggaaaattcaaatattccctggaag
aatctggccgaggctcaaaatactctgattttcctgatgggcatggaaaacctggaactg
atttgcgggaagcttttggagcatgggcgctcagcaaaaacacccgtaggaatcattgag
tggggaacatattccaaacagcgcgtcatatccggcgagcttggcggcattgcttccata
gcccgggcgaaaaggctggagaacccggcagttattgtggttggagaagttgtctcttta
agagaaaaactgaactggcttgaacgcagacccttgttcggacaaacaatcattgtgacc
agagcaagccatcaggccgccggcttgtcccaagccattgaagagctggggggggaagct
ctggaatttccggtaatcaagattaccgagcctgcggattctcagcttttactcagggca
atggaaaatctggacagcttgtcctggctcatctttaccagtgtaaacggggtagaagcc
ttttttgctgaactggggcgccgggggaaagatatccgggagcttgccggagtgaaaatc
gcggctattggcccggtgactcaagcagccctgaccaaaaggggattatctgtttctttt
gtccccgaagaattcagaaatgaaaaaatagccgaaggcctggccggtaagctcatcccg
ggggagcgtgttctcctggcaagagcgcaggaggcgtcgggcctgctgccgcaagccttg
gcagcttcaggcgcggatgtctgggatgtgcctgtctatagaacggttccgggagaggcg
gataaagaccggctgcgggatctgctggaaaataaggagatagacggggtgacatttacc
agcccttcaaccgtatctcattttctccgcttattggacggcaagaaagatttgctgtcc
aaggtaaagctatgttcaattggccctgtgaccagcgccgccttgcaagaaatggggctg
cctgttttttctgaggccaaggagtatacagttgaaggcctggtgaaagccatgattcag
ggaccggcttaa

DBGET integrated database retrieval system