KEGG   Staphylococcus haemolyticus: SH0373Help
Entry
SH0373            CDS       T00250                                 

Gene name
adhC
Definition
Zn-dependent alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sha  Staphylococcus haemolyticus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SH0373 (adhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SH0373 (adhC)
  Lipid metabolism
   00071 Fatty acid degradation
    SH0373 (adhC)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SH0373 (adhC)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SH0373 (adhC)
   00626 Naphthalene degradation
    SH0373 (adhC)
Enzymes [BR:sha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SH0373 (adhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
388114..389241
Genome map
AA seq 375 aa AA seqDB search
MKTRAAVLYEMEASQPYKESKPLKIESLELEDPHEHEVLLKIHAAGLCHSDLSVINGSRP
RPLPMALGHEATGEVLKVGSSVTRVKEGDHVVCTFIPSCGKCIPCKEGRPALCENGAKAN
EKGEMLEGGIRLSNEDGQVYHHLGVSGFAEHAVVSENSIVKISNEIPFERAAVFGCAVIT
GIGAVMNTAQIRPGSNVAVVGLGGIGLNAIIGAKLAGANEIIALDINEDKFDLAKQFGAT
ATFNSSDDDIDEQIKEYVPGGVEYAFETAGVVPAMQVAYRITKRGGTTVTTGLPHPKDEF
SFPQVTLAAEERTVKGSYVGSCVPDRDIPRFVSLYKQGRLNIDPLISEVITLDDINEGFD
KLASGDVGRIIVKMH
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagagcagcagtattatatgaaatggaagcatctcaaccttataaagaatcg
aaacctttaaaaattgagagcttagagttagaagatcctcatgagcatgaagtattgcta
aaaatacatgcagcagggctatgccattcagacttatcagtaattaacggcagtagacct
cgacctttaccgatggcacttggtcatgaggcaactggcgaggtattaaaagttggaagt
agtgtcacaagggtgaaagaaggtgaccatgtagtttgtaccttcattccaagctgtggt
aaatgtataccatgtaaagaaggacgtccagctttgtgtgaaaatggagctaaagcaaat
gaaaaaggcgaaatgttagaaggaggtattcgattatctaatgaagatggacaagtatat
catcatttaggcgtctctggatttgcagaacacgcagtggtttctgaaaattctattgta
aaaatcagtaatgaaataccatttgaacgtgcagcagtatttggctgtgctgtcattaca
ggtattggtgctgtgatgaatacagctcaaattcgtccaggtagtaatgttgctgtggtt
ggactaggtggtataggattaaatgccattattggtgctaagttagcaggtgcaaatgaa
attattgcactagatattaatgaagacaaatttgatttagctaagcagtttggagctacc
gcgacatttaactctagtgatgatgatatagatgaacaaattaaagaatatgtacctggc
ggagtagaatatgcatttgaaacagcaggggttgttcctgcaatgcaagtcgcttataga
attactaaacgagggggtactacagtaacaacgggcttacctcatcctaaagatgaattc
tcatttcctcaagtaacattagctgcagaagaacggacagttaaaggttcttatgtagga
agctgtgttcctgatagagatattcctcgttttgtaagtttatataaacaaggaagatta
aacattgatccactcattagtgaagtgattactctagatgatatcaatgaaggatttgat
aaattagctagtggtgatgtcggtagaattattgttaaaatgcattga

DBGET integrated database retrieval system