KEGG   Staphylococcus haemolyticus JCSC1435: SH0436Help
Entry
SH0436            CDS       T00250                                 

Gene name
acs
Definition
(GenBank) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00010  Glycolysis / Gluconeogenesis
sha00620  Pyruvate metabolism
sha00640  Propanoate metabolism
sha00680  Methane metabolism
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
sha01120  Microbial metabolism in diverse environments
sha01130  Biosynthesis of antibiotics
sha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SH0436 (acs)
   00620 Pyruvate metabolism
    SH0436 (acs)
   00640 Propanoate metabolism
    SH0436 (acs)
  Energy metabolism
   00680 Methane metabolism
    SH0436 (acs)
Enzymes [BR:sha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SH0436 (acs)
Lipid biosynthesis proteins [BR:sha01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SH0436 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAE03745
NITE: SH0436
UniProt: Q4L9D0
Position
456335..457930
Genome map
AA seq 531 aa AA seqDB search
MDNSSLLAPETYNIVSEIEKHASNTSKKALIYENGVDEPITVTYSELIKNANKVGHVLLN
HGLKKGDKVLIMMPRAIMTYELYLAALKLGIAIIPSSEMLRTKDLQYRITHGEIKAVIAK
SDFIEEFKGVKEYDSLTKFIIDGHETDWINIEDEKASQSDALDIEKTSRDDLAILSYTSG
TTGNPKAVTHSHGWGFAHMKMAPEHWLCIKEDDLVWATAAPGWQKWVWSPFLSIMGSGAT
AFVYNGKFNPSRYLELLQGFEINVLCCTPTEYRMMAKLDNLQEYNLEHLHSAVSAGEPLN
REVVEQFRNNFNLTVRDGYGQTESTLLIGFLKDTKSRPGSMGKEIPGSRVTIVDDEGQPV
ETNVKGNIALPLDFPGLFKGYYKDEERTKAAQAGDYYITGDLAHIDEDGYFWFEGRRDDI
IISSGYTIGPFEVEDALTNHPAVKECAVVASPHEIRGNIVKAFVILQDNYQGNDDLVKEL
QTFAKNEVAPYKYPRAIEFVDSLPKTNSGKIRRVELRDAEREKYNKENGFK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggataattcaagtttattagcaccagagacttacaatattgtttcagaaattgagaaa
catgcttctaatacatcgaagaaagccctgatttatgaaaatggggtagacgaaccaatt
acagtgacatattcagaattaattaaaaatgccaataaagtgggacatgtcttattaaat
cacggacttaaaaaaggtgataaggtattaatcatgatgccgagagcaattatgacatat
gaactttatcttgctgcattaaaactgggtattgcgattattcctagttcagaaatgcta
agaactaaagatttacaatatcgaattacacatggtgagattaaagcagtaattgctaaa
tctgattttattgaagagttcaaaggcgttaaagagtatgactcattaacgaaatttatc
attgacggacacgaaacggactggattaatattgaagatgaaaaagcgtctcaaagtgat
gcgttagatattgaaaaaacttcaagagacgatttagccatcttatcatatacatctgga
acgacaggaaatcctaaggctgttacacattctcatggttggggatttgcacacatgaaa
atggcgccagaacattggttatgtattaaagaagacgacttagtgtgggcgacagctgca
ccaggttggcaaaaatgggtatggagtcctttcttatcaattatgggttcaggcgcaaca
gcatttgtttataatggtaaattcaacccttctcgttatcttgaattattacaaggcttt
gaaatcaatgtcttatgttgtacaccaacagaatatcgtatgatggcgaaattagacaat
ttacaagaatataacttagaacaccttcacagtgctgtatcagcaggcgagccattaaac
cgtgaagttgtagaacaattccgcaataactttaatttaacggtgcgtgatggttatgga
caaacagagagtactttattaatcgggttcttaaaagacactaaatcacgaccaggttca
atgggtaaagaaatcccaggtagccgtgttacgatcgttgatgatgaaggacaaccggtt
gaaacaaatgttaaaggaaatatagctttaccacttgatttccctggtttgtttaaaggt
tattataaagatgaagaacgtacgaaagcagctcaagcgggtgactattacattactgga
gacttagcgcatatagatgaagatggctatttctggtttgaaggtcgacgagatgatatt
atcatcagttcaggctatacgattggaccgtttgaagttgaagatgccttaacaaatcac
ccggccgttaaagaatgtgctgttgtagcaagtcctcatgaaattcgaggcaacattgtt
aaagcattcgttattttacaagataattatcagggtaatgatgaccttgttaaagaatta
caaactttcgcgaagaatgaagtagcaccatataaatacccacgtgcaattgaatttgta
gactcattacctaaaacaaattcaggtaaaatccgtcgtgttgaattacgcgatgctgaa
cgtgagaaatataataaagaaaatggatttaaataa

DBGET integrated database retrieval system