KEGG   Staphylococcus haemolyticus JCSC1435: SH0510Help
Entry
SH0510            CDS       T00250                                 

Gene name
mvaC
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SH0510 (mvaC)
   00630 Glyoxylate and dicarboxylate metabolism
    SH0510 (mvaC)
   00640 Propanoate metabolism
    SH0510 (mvaC)
   00650 Butanoate metabolism
    SH0510 (mvaC)
  Lipid metabolism
   00071 Fatty acid degradation
    SH0510 (mvaC)
   00072 Synthesis and degradation of ketone bodies
    SH0510 (mvaC)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SH0510 (mvaC)
   00310 Lysine degradation
    SH0510 (mvaC)
   00380 Tryptophan metabolism
    SH0510 (mvaC)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SH0510 (mvaC)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SH0510 (mvaC)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SH0510 (mvaC)
Enzymes [BR:sha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SH0510 (mvaC)
Exosome [BR:sha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SH0510 (mvaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
524389..525540
Genome map
AA seq 383 aa AA seqDB search
MKKIAIVSAKRTPIGRYKGKLRNYSAVELGTTALKGAIDSANIDPNIIQQVIFGNVLQSG
VGQNPARQIAIKAGVPDTTPAMTINEVCGSGLKAIILGKQLIQLGEADVVAVGGVESMTN
APQLILKEGQEPVESFMHDGLTDAFHYVPMGVTAENIAEKYDITREMQDEFANHSQAKAA
KATQDGKFNNEIIGMTDAEGEQMTSDEGVRPNSSVEKLATLKTIFKEDGTVTGGNASSIN
DGSSALILMEESYAKAHGYDILGIVGDYAEVGCDPQYMGYAPFYAVEKLLDKTDSKIDDV
DIVEMTEAFAAQSIPVKDNLHIPDEKLNIYGGAIALGHPIGASGARLVTTLVNALEQENK
RTGIATACIGGGLGIALMIDKGE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgctatagttagtgctaaaagaacgccaatcggtagatataaaggtaaa
ttaagaaattattctgcagttgaattgggaacgacagctttgaaaggtgcaatcgattca
gcaaatattgatcctaatataatacaacaagttattttcggtaatgtgctacaaagtggt
gtaggacaaaacccagcacgtcaaattgcgattaaagcgggtgtacctgatacaacacca
gctatgacaattaatgaggtatgtggatcaggtcttaaagcaattatattagggaaacag
ttaattcaattaggtgaagcggatgtagtagcagtgggtggagttgaaagtatgacaaat
gccccacaattaatcttaaaagaaggtcaagaaccagtggaaagttttatgcatgatggt
ttaacagatgcctttcattatgtaccaatgggtgtaacagctgagaacatagctgaaaaa
tatgacatcacgcgtgaaatgcaagatgagttcgcaaatcattcacaagctaaagcagct
aaagcgacgcaagatggtaaatttaataatgaaatcatcggtatgactgacgcagaaggg
gaacaaatgacttctgatgaaggtgttcgcccaaatagtagtgttgagaagcttgcgaca
ttaaagacaattttcaaagaagatgggacagtaactggtggtaatgcttcaagtattaat
gatggttcatctgcactcattttaatggaagaatcatatgctaaagcgcatggttacgat
attttaggaattgttggagattatgcagaagtaggttgtgacccacaatatatgggctat
gcgccattctatgctgttgagaagctacttgataaaacggatagcaaaatcgatgacgtt
gatattgtagaaatgactgaagcatttgctgcacaaagtataccagtcaaagacaatttg
catattccagatgaaaaattaaatatctatggcggtgctattgcactaggacacccaatt
ggtgccagtggtgctagattagtcactactttagtgaacgcacttgaacaagaaaataaa
cgtacgggtattgctacagcatgtattggtggaggactaggtatcgctctaatgattgat
aaaggggaataa

DBGET integrated database retrieval system