KEGG   Staphylococcus haemolyticus: SH0579Help
Entry
SH0579            CDS       T00250                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sha  Staphylococcus haemolyticus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SH0579 (gtaB)
   00052 Galactose metabolism
    SH0579 (gtaB)
   00500 Starch and sucrose metabolism
    SH0579 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    SH0579 (gtaB)
Enzymes [BR:sha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SH0579 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
590833..591699
Genome map
AA seq 288 aa AA seqDB search
MKQIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASRAGIEDIIIVTGKH
KRAIEDHFDNQKELEMVLEEKGKDDLLEKVQYSTDLANIFYVRQKEQKGLGHAIHTARQF
IGNEPFAVLLGDDIVESETPAIKQLMNVYEETGHSVIGVQEVPESVTHRYGIIDPLEKEG
RRYEVKQFVEKPKQGTAPSNLAIMGRYILTPEIFDYLETQKEGAGNEIQLTDAIERMNSD
IPVYAYDFDGDRYDVGEKLGFVKTTIEYALKDPKMKDELIKFIKELGF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacagataaaaaaagcaatcatacctgctgctggtttagggacgcgattcttacca
gctactaaagcgatgcctaaagaaatgcttcctattctagacaaacctacaattcaatac
atagtggaagaggcttctcgtgcaggaattgaagatattatcatcgtaactggtaaacat
aaacgtgcaattgaagatcattttgataatcaaaaagaattagaaatggttcttgaagaa
aaaggaaaagatgacctacttgagaaagtacaatattctacggacttagcaaacatcttc
tacgttcgacaaaaagaacagaagggattaggacatgcgattcatacagcacgtcaattt
attggaaatgaaccatttgcagtcttattaggtgatgacattgttgaatcagagacacca
gccatcaaacaattgatgaacgtttacgaagaaacaggtcattcagtcattggtgttcaa
gaagtaccagagagcgttactcatagatatggtattattgatccattagaaaaagaaggc
cgtcgttacgaggtaaaacaatttgttgagaaaccgaaacaaggtacagcaccttcaaat
ctagccatcatgggacgttacatcttaacacctgagatatttgactaccttgaaacacaa
aaagaaggcgctggaaatgaaattcagctcactgatgcgattgaacgtatgaatagtgat
attccagtttatgcatacgactttgatggcgatcgttatgatgttggagaaaaattaggc
ttcgttaaaacaacgattgaatatgcacttaaagatccaaagatgaaagatgaacttatt
aagtttataaaagaattaggattttaa

DBGET integrated database retrieval system