KEGG   Staphylococcus haemolyticus: SH0718Help
Entry
SH0718            CDS       T00250                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sha  Staphylococcus haemolyticus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SH0718
   00052 Galactose metabolism
    SH0718
Enzymes [BR:sha01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SH0718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
739538..740548
Genome map
AA seq 336 aa AA seqDB search
MIVEVEKQRHGIDLIKIDNDETNIVFTNFGARIVSWKYHDNNIVLGNRVEADEFYPSNPY
HFGATIGRYAGRIGNAKFHLNDEEYQLEANNNVHHLHGGSNGLDKRLFNYDIQDNITNIK
VTFTVQLKSMEDGYPGDMTIKVIHTYDVEHRWTVEYEAKTNQDTLFNPTNHVYFNLNRDN
NVIDNHKIKSEQLNMYPIDRNNLIENTSSIDLLAIFKTNSISFSDIFNSDNELLKEQIGS
RNGLDHPFDVGNQQFFIENDEFQLDVTSSMPNVVIYTFNDTKDWDSDFNIYKPHSGISLE
TQFLPNDINLYGNKVNSILKANEHFYSKTTYHISEK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgaagtagaaaagcaaagacatggtattgacttaattaaaattgacaacgat
gaaaccaatattgtattcacaaatttcggtgcgcgcatcgtatcatggaagtaccatgat
aacaacattgtattaggcaatagagttgaagcggatgagttttatccatcaaatccgtat
catttcggtgctactatcggtcgctatgctggacgtattggaaatgccaaatttcatttg
aacgatgaggaatatcaattagaagctaataataacgtacatcaccttcatggtggtagt
aatggtttagataaaagactttttaattacgacattcaagataatatcacgaatattaag
gttacttttacagttcaactaaagtcaatggaagatgggtatccaggggatatgactatt
aaagtgatacatacttatgacgtcgaacaccgttggacagtagaatatgaagcaaagaca
aatcaagatacattatttaatccaactaatcatgtttattttaatttgaatagagacaat
aatgttatagataatcataaaattaagagtgagcaattaaatatgtatccaattgatcga
aacaatcttattgaaaatactagttcaattgatttgttagctatttttaaaacaaacagt
atatcttttagtgatatttttaactctgataatgaactacttaaagagcaaattggttca
agaaatggattagatcacccttttgatgttggaaatcaacaatttttcattgaaaatgat
gagtttcaattagatgttacgtcatctatgccaaacgttgtcatctatacatttaatgat
acgaaagattgggatagtgattttaatatttataaaccacattcaggtatatccctagaa
acacaatttttacctaatgatattaatttgtatggtaataaagtaaactctattttaaaa
gctaacgagcatttttattctaaaacaacttatcatatatcagaaaaataa

DBGET integrated database retrieval system