KEGG   Staphylococcus haemolyticus: SH0911Help
Entry
SH0911            CDS       T00250                                 

Gene name
murZ
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sha  Staphylococcus haemolyticus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sha00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sha00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
918638..919909
Genome map
AA seq 423 aa AA seqDB search
MTQEVIKIRGGQTLKGDVTISGAKNSAVAIIPATLLAQGQVKLDGLPQISDVETLVSLLE
DLNIKAHLNGKTLEVDTSEIENAPLPNNKVESLRASYYMMGAMLGRFKKCVIGLPGGCPL
GPRPIDQHIKGFKALGAEIDESNDTSMKIEAKELHGANIFLDMVSVGATINIMLAAVHAT
GQTVIENAAKEPEVVDVANFLNSLGADIKGAGTSTLKINGVDSLHGSEYQIIPDRIEAGT
YMCIAAAVGEEITINNIVPKHVEALTVKLKELGVDIQVDGDAEKAIIKRKSSYKNVDIKT
LVYPGFATDLQQPITPLLFMADGPSFVTETIYPARFRHVDELKNMGANIEADMETGTATI
KPSSLNGAEVYASDLRAGACLIIAGLLAEGVTTIYNVRHIYRGYTDIVKHLKELGANIWT
EEV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagaggtaataaaaattcgcggtggtcaaacactaaagggagacgttacgata
agtggtgccaaaaatagtgcggtagcaattatcccagcaacattattagctcaaggccaa
gttaaattagatggcttaccacaaatttccgatgtagagacgctagttagtttattggaa
gatttaaatattaaagcccatttaaatggaaaaactttagaagtagatacttcagaaatt
gaaaatgcaccactgcctaacaacaaagttgaatctcttagagcatcttattacatgatg
ggagcaatgttagggcgttttaaaaaatgtgtaataggtttacctggtggttgtccatta
gggccacgtccaattgatcaacatattaaaggttttaaagcattaggagcagaaatagat
gaatcaaatgatacatctatgaaaattgaagctaaagaactacatggtgctaatatcttc
ttagatatggttagtgtaggcgcaacaatcaacattatgttggcagctgttcatgcaact
ggtcaaacagtcattgaaaatgcagctaaagaacctgaagttgtagatgttgctaatttc
ttgaacagtcttggcgcagatattaaaggggcagggacaagtacgttaaaaattaatggt
gttgatagcttacatggttctgaatatcaaattatccctgatcgtattgaagcagggaca
tacatgtgtatagcggcagcagttggagaagaaattactattaataatattgttccaaaa
catgttgaagcacttactgttaaattaaaagaacttggtgtagacattcaagtagatggt
gatgctgaaaaagcaatcatcaaacgcaaatcatcttataaaaatgtagatattaaaaca
ttagtataccctgggtttgcaacagatttacaacaaccaatcacgcctttattgtttatg
gcagatggcccttcatttgtaacagaaacaatatatcctgcgcgatttagacatgtcgat
gagttaaaaaatatgggtgctaatattgaagccgatatggaaactggaactgctacaatt
aaaccatcatcacttaatggtgctgaagtatatgcaagtgatttgcgtgcaggtgcatgt
ttaattattgcaggtcttttagctgaaggcgttactacaatttataacgttagacatatt
tatagaggctatactgacattgttaagcatttaaaagaattaggtgcaaatatttggact
gaagaagtctaa

DBGET integrated database retrieval system