KEGG   Staphylococcus haemolyticus: SH0935Help
Entry
SH0935            CDS       T00250                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sha  Staphylococcus haemolyticus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sha00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sha00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
939291..940556
Genome map
AA seq 421 aa AA seqDB search
MDKIVIKGGNRLTGEVKVEGAKNAVLPVLTASLLASEGQSKLVNVPDLSDVVTINNVLST
LNANVEYNKEEGAVLVDASTTLKEEAPYEYVSKMRASILVMGPLLARLGHAIVALPGGCA
IGARPIEQHIKGFEALGAEIHLENGNIYASTKDGLKGTDIHLDFPSVGATQNIIMAASLA
KGKTVIENVAKEPEIVDLANYINEMGGKVTGAGTDTITIHGVEKLRGVEHSIIPDRIEAG
TLIIAAAITRGDVFVRDAVKEHMTSLIYKLEEMGVNLDFQEDGVRVTAEDELKPVDVKTL
PHPGFPTDMQSQMIALLLTAEGHKVITETVFENRFMHVAEFRRMNANITVEGRSAKIQGK
SQLQGAQVKATDLRAAAALILAGLVAEGTTQVTELKHLDRGYVNFHEKLKSLGANIERVN
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatagttataaaaggtggcaatcgcctaactggagaagttaaagttgaagga
gctaaaaatgcagttttaccagtactaactgcatcactgttagcatcagaaggtcaaagt
aaacttgttaacgttccagatctaagtgatgttgtaacaataaataatgtgttatcaaca
ttaaacgctaatgtggagtataacaaagaagaaggtgctgtattagttgatgcatctaca
acattaaaagaagaggcaccttatgaatatgttagtaagatgcgtgcgagcatattggtt
atgggtcctttactagctcgattaggacatgccattgtcgcattaccaggtggttgtgca
attggtgcacgaccaatagagcaacatattaaaggttttgaagctctaggtgctgaaatt
caccttgaaaatggaaatatttatgctagtacaaaagatggtttaaaaggtacagatatt
catttggatttccctagtgtaggtgcaactcaaaacattattatggctgcttcacttgca
aagggtaaaacagtaattgaaaatgttgctaaagaacctgaaattgttgatttagcaaac
tatatcaatgaaatgggtggtaaagttaccggagctggtactgatactattacaattcat
ggtgtcgaaaaattaagaggtgttgaacattcaattattccagatagaattgaagcaggt
acccttatcatagctgctgcaattacacgtggtgatgtatttgttagagacgctgtgaag
gaacacatgactagtttaatttataaactagaagaaatgggtgttaatttagatttccaa
gaagatggtgtaagagtcactgctgaggatgaacttaaaccagttgacgttaaaacattg
ccacatcctggattcccaacagatatgcaatcacaaatgattgcgttattattaacagct
gaaggtcataaagtgataactgaaacagtcttcgaaaatagatttatgcacgttgccgaa
ttcagacgtatgaatgcaaatattactgtagaaggcagaagcgctaaaatacaaggtaag
agtcaattacaaggtgctcaagttaaagcaacggatttacgtgcagctgcagcattaata
ttagctggtttagtagctgaaggtacaactcaggttactgaattgaaacatttagaccgt
ggttacgttaatttccatgagaaattaaaatcattgggcgctaacattgaaagagtaaat
tattaa

DBGET integrated database retrieval system