KEGG   Staphylococcus haemolyticus: SH1226Help
Entry
SH1226            CDS       T00250                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sha  Staphylococcus haemolyticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SH1226 (pfkA)
   01230 Biosynthesis of amino acids
    SH1226 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SH1226 (pfkA)
   00030 Pentose phosphate pathway
    SH1226 (pfkA)
   00051 Fructose and mannose metabolism
    SH1226 (pfkA)
   00052 Galactose metabolism
    SH1226 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SH1226 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SH1226 (pfkA)
Enzymes [BR:sha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SH1226 (pfkA)
Protein phosphatases and associated proteins [BR:sha01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SH1226 (pfkA)
Messenger RNA biogenesis [BR:sha03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SH1226 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1258306..1259229
Genome map
AA seq 307 aa AA seqDB search
MNAAVRAVVRKAIYNNIEVYGIYQGYQGLLDDNIHKLELGSVGDTIQRGGTFLYSARCPQ
FKEASVRQKGIENLHKRGIEGLVVVGGDGSYRGAQRISEETKDIKTIGIPGTIDNDINGT
DFTIGFDTALNTIIDSVDKIRDTASSHARTFIVEVMGRDCGDLALWAGLSVGAETILVPE
ANTDIKDIAEKIESGIKRGKKHSIVMVAEGSMSGQECADQLMKYINVDARVSVLGHIQRG
GSPSGADRVLASRLGGYAVDLLMQGRSGQGVGIMNNKLTATPFDEIFNGNDHKFNTDIYE
LAKELSI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgctgttagagcagttgtgcgtaaggcgatttataacaacattgaagtttat
ggaatttatcaaggttatcaaggattacttgatgacaatattcataaacttgaattgggt
tcagtaggggatacaattcaacgtggaggaactttcctttactctgcaagatgtccacaa
ttcaaagaggcgagtgtaagacaaaaaggtatagagaatttacacaaacgtggtattgag
ggactagtagtagttgggggagatggtagttaccgaggtgcccaacgtattagtgaagaa
acgaaagatatcaaaacaataggaattccaggtactattgataatgatattaatggtact
gacttcactattgggtttgacacagcgttgaacacgattattgatagtgtagacaagatt
agagacactgcttcaagtcatgctagaacttttattgtagaagttatgggtcgtgattgt
ggtgatttagcactttgggctggattatcagtaggtgctgaaacaatattagttccagaa
gctaatacagacattaaagatatcgctgaaaagatagaaagtggtatcaagcgtggtaag
aaacactcaatcgtgatggtagctgaaggaagtatgagtggtcaagaatgtgcggatcaa
ttgatgaaatatattaatgttgatgcacgtgtatctgtattaggtcacattcaacgtggc
ggtagcccatcaggtgccgatagagtattagcatcacgtttaggtggttatgctgttgac
ctattaatgcaaggtcgttctggacaaggtgttggtatcatgaataataaattgactgct
acaccatttgatgaaatcttcaatggcaacgaccataaatttaatacagatatttatgaa
ttagcgaaagagttatctatttaa

DBGET integrated database retrieval system