KEGG   Staphylococcus haemolyticus: SH1259Help
Entry
SH1259            CDS       T00250                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sha  Staphylococcus haemolyticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sha00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1294372..1295346
Genome map
AA seq 324 aa AA seqDB search
MKFDRHRRLRSSESMRNLVRENHVRKEDLIYPIFVVEKDNVKSEIKSLPGVYQISLNLLD
DEINEAYELGIRAIMFFGVPNAKDDVGSGAYDHNGIIQEATRKAKELHKDLLIVADTCLC
EYTDHGHCGVIDDHTHDVDNDKSLPLLVKTAISQVEAGADIIAPSNMMDGFVAEIRKGLD
NAGYYNIPIMSYGIKYASSFFGPFRDAADSAPSFGDRKTYQMDPANRLEAFRELESDLKE
GADMMIVKPALSYLDIVRDVKNNTNIPVIAYNVSGEYAMTKAAAQNGWIDEERVVMEQMV
SMKRAGADMIITYFAKDICHYLDK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgatagacatagacgattacgctcatcagagtcaatgcgtaatttagttaga
gaaaaccatgttagaaaagaagatttaatttatccaatattcgtagttgaaaaagataac
gtaaaaagtgagattaaatcacttccaggcgtttaccaaataagcttgaatttattagat
gatgaaataaatgaggcatatgaactaggtattagagcaatcatgttctttggtgtacca
aatgctaaagatgacgtaggttctggtgcatatgatcataatggtattatccaagaagca
acacgaaaggctaaagaattgcataaagatttattaattgtagcagatacatgtttatgt
gaatatacagatcatggacattgtggtgttattgatgatcacactcatgatgtagataat
gataaatcattacctttacttgttaaaacagctatctcacaagttgaagcgggagcagac
attatcgcaccaagtaatatgatggacggttttgttgcagaaattcgtaaaggtctagat
aatgccggctattacaatattccaattatgagttatggtatcaaatatgcatcaagtttc
tttggtccatttagagatgcggctgattctgcaccttcttttggtgacagaaagacttac
caaatggacccagcgaatcgcttagaagcatttcgtgaacttgaaagtgacttaaaagag
ggcgctgatatgatgatagtaaaacctgcgctaagttatttagatattgtaagagacgtt
aaaaacaatacaaatattcctgttattgcttataacgtaagtggtgagtatgcaatgaca
aaagcagcagcacaaaatggttggatagatgaagaacgtgttgttatggaacaaatggtt
tcaatgaaacgtgcaggtgcagatatgattattacttactttgcgaaagatatttgccat
tacttagataaataa

DBGET integrated database retrieval system