KEGG   Staphylococcus haemolyticus: SH1279Help
Entry
SH1279            CDS       T00250                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sha  Staphylococcus haemolyticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sha00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SH1279 (ruvA)
Enzymes [BR:sha01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SH1279 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1310270..1310875
Genome map
AA seq 201 aa AA seqDB search
MYAYIRGKLTQLFPTHVVVESINGVGYEIQTPNSYRFQKYLEKELVIYTSLIVREDAQLL
YGFINEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKMAIENENDAYLTKFPGIGKKT
ARQIVLDLKGKVQITRETTETLLSMNEENSNSENLVKEALLALEALGYSKREISKVEKVL
NKSTFDSVDEAVKLGLKTLVS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcttatattagaggtaaattgacgcaattatttccaacgcatgtagttgttgaa
tcaattaatggggttggatatgaaattcagactccaaattcctatcgatttcaaaaatat
ttggagaaagaattagtaatttatacatctttaattgttagagaagatgctcagttactt
tatggatttattaatgaagaagaaaaagatatgttcttaagtttaatcaaagttacaggt
ataggtccaaagtctgcattagcaattttagctactagtacaccaaatgaagttaaaatg
gcaattgaaaatgagaatgatgcttatttgactaagtttccaggtattggtaaaaaaact
gcacgtcaaattgtgctagatttaaaaggcaaagttcaaattacaagagaaacaactgag
acacttttaagtatgaatgaagaaaattcaaatagcgaaaacctagttaaagaagcatta
ctcgccctagaggctttaggttactcaaaacgagaaatttctaaagttgaaaaagtactc
aacaaatcaacatttgattctgttgatgaagcagtaaaactaggactaaaaacacttgtg
tcttaa

DBGET integrated database retrieval system