KEGG   Staphylococcus haemolyticus: SH1300Help
Entry
SH1300            CDS       T00250                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sha  Staphylococcus haemolyticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sha00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SH1300
Enzymes [BR:sha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SH1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1335222..1337660
Genome map
AA seq 812 aa AA seqDB search
MSDPTLFDYSMIKGTVDAILFQNNDNFYTVIKVETIETNESFGNLPTVVGFFPNIVEGDV
YTFKGQVVEHPRYGKQLKADTFEKEVPQTKDAIITYLSSDLFKGIGKKTAQNIVNTLGEN
AINDIMTDASVLEKVSNLPKKKQKQIADQINANQESEKIMIRLHDLGFGPKLSMAIYQFY
QSETLNVLENNPYQLVYDIKGIGFNKADTLARNNGISFNDPERLKAGLLYTLEEECIKQG
HTYLSLDYAIEVTLDMLMDAHSSDSIDSKQLENILELLNEEQKIIVNNERVAIPSLYYSE
LKSVQNLYRIKTYKHKLKEIEQSDLQIHIGDIETSNNVHYAPSQKEALQTAINSKIMLLT
GGPGTGKTTVIKGIVELYAEVHGLSLSYSDYQEDDYPIVLAAPTGRASKRLQESTGLEAM
TIHRLIGWNQETQPEDILDNEIKAKLIIIDEMSMVDTWLFHQFLSAVPLDAQIILVGDED
QLPSVGPGQIFKDLIDSKAIPRVNLTEVYRQQDGSSIIDLAHRMKHGEPIDITKRFHDRS
FISCNVDQIPKVVEKVVSSAVNKGYDMSDIQVLAPMYKGNAGIKRLNQVLQDILNPKAQD
TREIEFGDIKFRKGDKVLQLVNRPNDNIFNGDIGIIVGIFWAKENALNKDVMVVDFEGNE
ITFTRQDLLELTHAYCTSIHKSQGSEFPIVIMPIVKQYFRMLQRPILYTGLTRAKQSLVL
LGDSTAFEIGLNTQGQLRHTQLQELILSYFDIDHKQSDVTISNTVSKDEEAMNTIHDVDT
KDDQVILSESTLYQINPMINMGDVSPYDFVER
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccctacactatttgattattcaatgattaaaggtactgtagatgctatttta
tttcaaaataatgataatttctatacagtcattaaagtggaaacaattgaaactaatgaa
tcatttggtaatttaccaacagttgtagggttctttccaaatattgtggaaggagatgta
tacacttttaaaggacaagtggtagagcacccacgttatggcaagcaattgaaagccgac
acttttgaaaaagaggtccctcaaactaaggatgctattattacatatttatcaagtgac
ttattcaaaggtataggtaaaaaaactgctcaaaatattgtaaatacacttggtgaaaat
gcgataaatgatattatgacagacgcatcagttttagagaaggtttcaaatttaccgaaa
aagaaacaaaagcaaattgctgatcaaattaatgccaatcaagagtccgaaaaaattatg
attcgattacatgatttaggcttcggacctaaattatcaatggcgatttatcaattttac
caatccgagactttaaatgtgctcgaaaataacccttatcaactcgtttatgatattaaa
ggaattggttttaataaagctgatactttagctagaaataatggcattagttttaatgat
ccagaacgattgaaagccggattattatatacgctagaagaagaatgtataaaacaaggt
cacacctatttatcactagattatgccattgaagtgacattagacatgctaatggatgct
cattccagtgatagtatcgattcaaaacagcttgaaaatattctcgaattattaaatgag
gaacaaaaaattattgtaaacaatgagcgagtcgccattcctagtctttattactccgaa
ctcaaaagtgttcaaaatttatatcgaattaaaacatacaaacataagctaaaagaaata
gaacaatctgatttacagatacatataggggatatagagactagtaataatgtacattat
gcaccatctcaaaaagaggccttacaaactgcaattaattctaaaattatgcttttaacc
ggtggtcctggtacaggtaaaacaacagtaatcaaaggaatcgttgagctttatgcagag
gtacatggtctttctcttagttactcagactatcaagaagatgactatcctattgtcctt
gcagcaccaacaggtagagcatctaaacgattacaagaatctacagggttggaagcaatg
acaattcatcgtctaattggatggaatcaagaaacacaaccagaagacattctagataat
gaaattaaagcaaagctcataattattgacgaaatgtcgatggtagatacatggttgttt
caccaatttttaagtgcagttcccctagatgcacaaattattttagtcggtgatgaagat
caattaccttcagttggaccaggtcaaatatttaaggatcttattgattcgaaggcaata
cctcgagttaatctaactgaagtttatcgtcaacaagatggttcaagtatcatcgattta
gcgcatcgtatgaaacacggtgagccaatagatattacaaagcgttttcatgataggagt
tttataagttgtaatgtcgatcaaattcctaaagtagttgaaaaagtagtttcaagtgca
gttaataagggttatgatatgagtgatattcaagtcttggcgcctatgtataagggtaac
gcaggtattaaaagattaaatcaagtattacaagatattttaaaccctaaggcacaagat
acacgagaaattgaatttggtgatataaagtttcgtaaaggtgataaggttcttcagtta
gttaatcgtcctaatgataatatcttcaatggtgacataggaataattgttggtatattt
tgggctaaagaaaatgctttaaataaagatgttatggttgttgatttcgaaggtaacgag
attactttcactcgtcaagatttattagaattaacacatgcttattgcacatctattcat
aaatcacaaggatctgaatttcctattgtaattatgcctatcgtcaagcagtattttaga
atgttacagcgaccaatactttatacaggacttacacgtgctaaacaatcattagtatta
cttggagattcaaccgcatttgaaattggattaaatacgcaaggacaattacgacataca
caattgcaagagctaatcttgtcatattttgatatagaccataaacaaagtgatgtaaca
atttcaaatactgtgagtaaagatgaagaggcaatgaatacaattcacgacgttgatact
aaagatgatcaagtcattttaagtgaatctacgttatatcaaatcaatccaatgattaat
atgggggatgtttctccttatgattttgttgagcgttga

DBGET integrated database retrieval system