KEGG   Staphylococcus haemolyticus: SH1493Help
Entry
SH1493            CDS       T00250                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sha  Staphylococcus haemolyticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SH1493 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SH1493 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    SH1493 (odhB)
Enzymes [BR:sha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SH1493 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1534087..1535358
Genome map
AA seq 423 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEEGVLQEQLA
SEGDTVEVGQVIATVGEGSGNASSSKEESSDQSQSANNDEATKELAQPTESQSNNEETQS
NPNNQRVNATPSARRHARENGVDLSTVSGKGNDVVRKDDVENSQKAAQSQSSQETSKKEE
PKKSSGAPNKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQF
IKDHDGTKLGFMSFFTKAAVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF
VRDCDKKNFAELERAIADLAVKARDKKLGLDDMVNGSFTITNGGVFGSMMSTPIINGNQA
AILGMHSIITRPIAIDKDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIESPEDLL
LES
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggtaaaagttccagaattagcagaatctataacagagggtaccattgcagaa
tggttaaaaaatgtgggagatagcgttgaaaaaggcgaagctatcctagaattagagaca
gataaagtaaacgttgaagttgtttctgaagaagaaggtgtacttcaagaacaattggct
tctgaaggcgacactgtggaagttggccaagttatcgcaactgttggcgaaggtagtggt
aatgcttcttcaagcaaagaagaatcttcagaccaatctcaatctgcgaacaatgacgaa
gcgactaaagaattagctcaaccaacagaatctcaatcaaataatgaagaaacgcaatct
aatcctaacaatcaacgtgttaatgcaaccccatcagctcgtcgccatgcacgtgaaaac
ggtgtagatttaagcactgtttctggaaaaggaaacgatgttgtacgtaaagatgatgtt
gaaaatagtcaaaaagcagctcaatctcaatcttctcaagaaacaagcaaaaaagaagaa
cctaaaaaatcttcaggtgcacctaataaacctgtaattagagaaaaaatgtctcgtaga
aagaaaacagctgctaaaaaattattagaagtttctaataatacagcaatgttaactaca
ttcaatgaagtagatatgacaaacgtaatggaattacgtaaacgtaagaaagaacaattt
attaaagatcatgatggaactaaattaggtttcatgtcattctttactaaagctgctgta
gctgcattgaaaaaatatccggaagtaaacgctgaaattgacggcgatgacatgattact
aaacaatattatgacatcggtgttgcggtttctactgatgatggattattagttcctttc
gtaagagattgtgacaagaaaaactttgcagaacttgaaagagctattgctgacttagca
gttaaagcaagagataaaaaacttggtttagatgatatggttaatggatcatttacaatt
actaatggtggtgtatttggttcaatgatgagtactccaattattaatggtaaccaagca
gctattcttggtatgcactcaatcattacccgtccaattgcaattgataaagatacaatt
gagaatagaccaatgatgtatattgctttaagttatgaccatagaattattgatggtaaa
gaagcagtaggattcttaaaaacgattaaagaattaatcgaaagccctgaagatttactt
ttagaaagctaa

DBGET integrated database retrieval system