KEGG   Staphylococcus haemolyticus: SH1493Help
Entry
SH1493            CDS       T00250                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sha  Staphylococcus haemolyticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sha01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sha00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:sha00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1534087..1535358
Genome map
AA seq 423 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEEGVLQEQLA
SEGDTVEVGQVIATVGEGSGNASSSKEESSDQSQSANNDEATKELAQPTESQSNNEETQS
NPNNQRVNATPSARRHARENGVDLSTVSGKGNDVVRKDDVENSQKAAQSQSSQETSKKEE
PKKSSGAPNKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQF
IKDHDGTKLGFMSFFTKAAVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF
VRDCDKKNFAELERAIADLAVKARDKKLGLDDMVNGSFTITNGGVFGSMMSTPIINGNQA
AILGMHSIITRPIAIDKDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIESPEDLL
LES
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggtaaaagttccagaattagcagaatctataacagagggtaccattgcagaa
tggttaaaaaatgtgggagatagcgttgaaaaaggcgaagctatcctagaattagagaca
gataaagtaaacgttgaagttgtttctgaagaagaaggtgtacttcaagaacaattggct
tctgaaggcgacactgtggaagttggccaagttatcgcaactgttggcgaaggtagtggt
aatgcttcttcaagcaaagaagaatcttcagaccaatctcaatctgcgaacaatgacgaa
gcgactaaagaattagctcaaccaacagaatctcaatcaaataatgaagaaacgcaatct
aatcctaacaatcaacgtgttaatgcaaccccatcagctcgtcgccatgcacgtgaaaac
ggtgtagatttaagcactgtttctggaaaaggaaacgatgttgtacgtaaagatgatgtt
gaaaatagtcaaaaagcagctcaatctcaatcttctcaagaaacaagcaaaaaagaagaa
cctaaaaaatcttcaggtgcacctaataaacctgtaattagagaaaaaatgtctcgtaga
aagaaaacagctgctaaaaaattattagaagtttctaataatacagcaatgttaactaca
ttcaatgaagtagatatgacaaacgtaatggaattacgtaaacgtaagaaagaacaattt
attaaagatcatgatggaactaaattaggtttcatgtcattctttactaaagctgctgta
gctgcattgaaaaaatatccggaagtaaacgctgaaattgacggcgatgacatgattact
aaacaatattatgacatcggtgttgcggtttctactgatgatggattattagttcctttc
gtaagagattgtgacaagaaaaactttgcagaacttgaaagagctattgctgacttagca
gttaaagcaagagataaaaaacttggtttagatgatatggttaatggatcatttacaatt
actaatggtggtgtatttggttcaatgatgagtactccaattattaatggtaaccaagca
gctattcttggtatgcactcaatcattacccgtccaattgcaattgataaagatacaatt
gagaatagaccaatgatgtatattgctttaagttatgaccatagaattattgatggtaaa
gaagcagtaggattcttaaaaacgattaaagaattaatcgaaagccctgaagatttactt
ttagaaagctaa

DBGET integrated database retrieval system