KEGG   Staphylococcus haemolyticus JCSC1435: SH1536Help
Entry
SH1536            CDS       T00250                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SH1536 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SH1536 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SH1536 (trpA)
Enzymes [BR:sha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SH1536 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(1576642..1577373)
Genome map
AA seq 243 aa AA seqDB search
MTKLFIPYIMGNKSFIKNMKILDENGADIIEIGVPFSDPVADGPIIMEAGNRAIKQGVTI
NYIFNELSNNKDEINCKYVLMTYYNIIVSYGEEAFFKECEKVGVYGVIIPDLPYELTQKL
KHKISKFDVKVISLISMTANDDRIKEIVKHAEGFIYTVTMNATTGKNGTFHPQLKDKLKH
LKAHTDIPVVAGFGIRTKEHIKDLATVADGVVIGSEIVKRFCQDNNEDTIHYLKQVRETL
DTL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttattccatacattatggggaataagtcatttattaaaaatatgaaa
atcttagatgagaatggtgctgatataatagaaattggtgtaccattctctgacccagta
gctgatggtcccataataatggaagcaggcaaccgagctatcaagcaaggcgtgacaatt
aattacatttttaatgaattatccaataataaagatgaaattaattgcaaatatgtacta
atgacgtattacaatatcattgtttcttatggagaagaagctttctttaaagaatgtgaa
aaagtaggtgtttacggcgtgattattccggatttgccttacgaattaactcaaaaatta
aagcataaaatatccaaatttgatgttaaagtgatatctctcatatcaatgactgcaaat
gatgaccgtataaaagaaatcgttaagcatgctgaagggtttatatacactgtaactatg
aatgcaacaacaggcaaaaatggaacgtttcatcctcaattaaaagataaattaaaacat
ctaaaagcacatacggatattcctgtagttgcaggttttggcatcagaactaaagaacat
attaaggatttagctactgttgctgacggcgtagtcattggtagtgaaattgtaaaacgc
ttttgtcaagataataacgaggatacgattcactatttgaaacaagtaagagaaacgcta
gatacgctttag

DBGET integrated database retrieval system