KEGG   Staphylococcus haemolyticus JCSC1435: SH1536Help
Entry
SH1536            CDS       T00250                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00260  Glycine, serine and threonine metabolism
sha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
sha01130  Biosynthesis of antibiotics
sha01230  Biosynthesis of amino acids
Module
sha_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SH1536 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SH1536 (trpA)
Enzymes [BR:sha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SH1536 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth TMP-TENI PcrB NMO IMPDH DUF1194
Motif
Other DBs
NCBI-ProteinID: BAE04845
NITE: SH1536
UniProt: Q4L680
Position
complement(1576642..1577373)
Genome map
AA seq 243 aa AA seqDB search
MTKLFIPYIMGNKSFIKNMKILDENGADIIEIGVPFSDPVADGPIIMEAGNRAIKQGVTI
NYIFNELSNNKDEINCKYVLMTYYNIIVSYGEEAFFKECEKVGVYGVIIPDLPYELTQKL
KHKISKFDVKVISLISMTANDDRIKEIVKHAEGFIYTVTMNATTGKNGTFHPQLKDKLKH
LKAHTDIPVVAGFGIRTKEHIKDLATVADGVVIGSEIVKRFCQDNNEDTIHYLKQVRETL
DTL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttattccatacattatggggaataagtcatttattaaaaatatgaaa
atcttagatgagaatggtgctgatataatagaaattggtgtaccattctctgacccagta
gctgatggtcccataataatggaagcaggcaaccgagctatcaagcaaggcgtgacaatt
aattacatttttaatgaattatccaataataaagatgaaattaattgcaaatatgtacta
atgacgtattacaatatcattgtttcttatggagaagaagctttctttaaagaatgtgaa
aaagtaggtgtttacggcgtgattattccggatttgccttacgaattaactcaaaaatta
aagcataaaatatccaaatttgatgttaaagtgatatctctcatatcaatgactgcaaat
gatgaccgtataaaagaaatcgttaagcatgctgaagggtttatatacactgtaactatg
aatgcaacaacaggcaaaaatggaacgtttcatcctcaattaaaagataaattaaaacat
ctaaaagcacatacggatattcctgtagttgcaggttttggcatcagaactaaagaacat
attaaggatttagctactgttgctgacggcgtagtcattggtagtgaaattgtaaaacgc
ttttgtcaagataataacgaggatacgattcactatttgaaacaagtaagagaaacgcta
gatacgctttag

DBGET integrated database retrieval system