KEGG   Staphylococcus haemolyticus JCSC1435: SH1537Help
Entry
SH1537            CDS       T00250                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00260  Glycine, serine and threonine metabolism
sha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
sha01130  Biosynthesis of antibiotics
sha01230  Biosynthesis of amino acids
Module
sha_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SH1537 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SH1537 (trpB)
Enzymes [BR:sha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SH1537 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAE04846
NITE: SH1537
UniProt: Q4L679
Position
complement(1577366..1578577)
Genome map
AA seq 403 aa AA seqDB search
MYNIQTEADELGFFGEYGGQYVPETLMPAIIELKQAYNKAKQDQSFQDELTYYLKEYVGR
ETSLTYAKSYSEALGGAQIYLKREDLNHTGAHKINNAIGQALLAKRMGKNKLVAETGAGQ
HGVASATVAALFDMELIVFMGREDIKRQQLNVFRMELLGAKVEAVDEGQGTLSDAVNKAL
QYWVSHVEDTHYLLGSALGPDPFPTMVRDFQSVIGQEIKEQLLQKTGRLPDAVVACIGGG
SNAIGTFYPFIKDKVKLYGVEAAGQGIDTVKHALAIGKGRPGVLHGSKMYLIQDENGQVE
LAHSISAGLDYPGIGPEHSYYHDIGRVQYKHATDTEAMEALIRFSKMEGIIPAIESAHAL
SYVEKLAPKMNKDEILVVTISGRGDKDMETIRHYMQTRGESHD
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtataatatacaaactgaagcagatgaattaggttttttcggagaatatggtgggcaa
tatgttccagagacattaatgccagcaattatagaattaaaacaagcgtataacaaggct
aaacaagatcaatcgtttcaagatgaattaacttattatttgaaagaatatgtagggaga
gaaacctcattgacttatgcaaaatcatatagtgaagcgttgggtggagctcaaatatat
ttaaaacgtgaggatttgaaccataccggcgcacataaaattaataatgcgatagggcaa
gctttattggcaaaacgtatgggcaaaaataaattagttgctgaaacgggcgcaggtcag
catggtgttgctagtgccacagtagctgcattatttgatatggaattaatcgtatttatg
ggaagagaagatatcaaacgtcaacagcttaatgtatttcgcatggaattattaggagct
aaagttgaagcagtggatgaaggtcaaggaacactttctgatgcggtaaacaaggcatta
cagtattgggttagtcatgttgaagatactcactatttactaggttcagcattaggacct
gatccttttccaacgatggtcagagattttcaaagtgttataggtcaagaaattaaagaa
caattacttcaaaaaactggtcgattaccagatgcagttgttgcatgtataggtggaggg
tctaatgcaatagggaccttttatccatttattaaagataaggtcaaattatatggtgta
gaggctgcaggacaagggattgatactgttaagcacgcacttgcaattggaaaaggacgt
ccaggcgtacttcatggttcaaaaatgtacttaattcaagatgaaaatggacaagtagaa
ttagcacactctatatctgcaggtttagattatccaggtataggtcctgaacattcatat
tatcacgatattggacgtgtgcaatataaacatgccactgatacagaagcaatggaggcg
ctcatccgcttcagcaaaatggaaggaatcatacctgccattgaaagtgcacatgcactt
agttatgttgaaaagttagcacctaaaatgaataaagatgaaattttagtagttactatt
tcaggtcgcggtgacaaggatatggaaacaattagacactatatgcaaacaagaggtgag
tcacatgactaa

DBGET integrated database retrieval system