KEGG   Staphylococcus haemolyticus JCSC1435: SH1578Help
Entry
SH1578            CDS       T00250                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00260  Glycine, serine and threonine metabolism
sha00750  Vitamin B6 metabolism
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
sha01120  Microbial metabolism in diverse environments
sha01230  Biosynthesis of amino acids
Module
sha_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SH1578 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SH1578 (thrC)
Enzymes [BR:sha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SH1578 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 DUF4687
Motif
Other DBs
NCBI-ProteinID: BAE04887
NITE: SH1578
UniProt: Q4L638
Position
complement(1625345..1626406)
Genome map
AA seq 353 aa AA seqDB search
MKRWQGLVEEFKEYLPVNSDTPKLTLNEGHTPLIHCENLSKMLDIDLYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKVVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAENDEEIELVNSVNPYRIEGQKTGAFEIVEQLEQAP
DVLAIPVGNAGNITAYWKGFKEYHEKKGSQLPRLFGFQAEGASPIVQNKVIKNPETIATA
IRIGNPASWTKATNALDESNGLIDSVTDEEILEAYQLMTSKEGVFSEPASNASIAGLIKL
HRAGQLPKGKKIVAILTGNGLKDPDTAISILDNPIQPLPNDKSSIIDYIKGAL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatggcaaggtttagttgaagagtttaaagaatatttaccagttaacagcgac
acacctaagttaacattaaatgaaggacatactccattaattcattgtgagaacttgtct
aagatgttggatattgatttatatgtaaaatatgaaggtgcaaatcctacaggttctttt
aaagatagaggtatggtcatggcagttactaaagcaaaagaacaagggaaaaaagttgtt
atctgtgcatctactggtaatacatcagcttcagcagctgcatatgctgcacgagctgga
ttaaaagcaattgtagttattccagagggtaagattgcactcggtaaattatcgcaagct
gttatgtatggtgctgaaattgtttctattgaaggaaactttgatgaggctttagaaatt
gttaaggaaattgctgaaaatgatgaagaaattgagttagttaattcagtgaatccgtat
cgtattgaaggacaaaaaacgggtgcatttgaaattgttgaacaattggaacaagctcca
gacgtactcgcaattccagttggaaacgcaggcaatattactgcttattggaaaggtttt
aaagaataccatgagaaaaaaggtagtcaattacctcgattatttggcttccaagcagaa
ggtgcgtcaccaattgttcaaaataaagtgattaaaaaccctgaaacaattgctacagct
attcgaattggtaatccagctagttggacaaaagctacgaatgcgttagacgaatctaat
ggattgattgatagcgttactgatgaagaaattttagaagcttatcaattaatgacttct
aaagaaggtgtatttagcgaaccagctagtaacgcctcaattgcaggtctgattaaatta
catcgagcaggacaattacctaaaggcaaaaaaatagtagctattttaactggtaatgga
ttaaaagatcctgatactgctatttcaatattagataaccctattcaaccgcttcctaac
gataaatcaagtattattgattacattaaaggagctttgtaa

DBGET integrated database retrieval system