KEGG   Staphylococcus haemolyticus JCSC1435: SH1668Help
Entry
SH1668            CDS       T00250                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase (beta subunit)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00020  Citrate cycle (TCA cycle)
sha00640  Propanoate metabolism
sha00660  C5-Branched dibasic acid metabolism
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
sha01120  Microbial metabolism in diverse environments
sha01130  Biosynthesis of antibiotics
sha01200  Carbon metabolism
Module
sha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SH1668 (sucC)
   00640 Propanoate metabolism
    SH1668 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SH1668 (sucC)
Enzymes [BR:sha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SH1668 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: BAE04977
NITE: SH1668
UniProt: Q4L5U8
Position
complement(1723525..1724691)
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELDTEIYVVKAQIHAGGRGKAGGV
KIAKSLSEVETYANELLGKQLVTHQTGPEGKEVKRLYIEQGCDIQKEYYVGFVIDRATDR
ITLMASEEGGTEIEEVAAKTPEKIFKETIDPVVGLSPYQARRIAFNINIPKESINKAAKF
LISLYNVFIEKDCSIVEINPLVTTGEGEVLALDAKINFDDNALFRHKDIQELRDLEEEDP
KEIEASKYDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDVGGGATKEKVTE
AFKIILGDDNVKGIFVNIFGGIMKCDVIAEGIVAAVKEVELTLPLVVRLEGTNVERGKEI
LNESGLAIEPAATMAEGAQKIVKLVKEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgaatatcaaggtaaagaaatatttcgttctatgggcgtagccgttcca
gaaggacgagttgcatttactgctgaagaagcagtggaaaaggctaaagaattagacaca
gagatttatgtggttaaagcacaaatccacgctgggggtagaggtaaagcaggtggagtt
aagattgctaaatcattatctgaggttgaaacttatgccaatgaattattaggtaaacaa
ttagttacacatcaaactggacctgaaggtaaagaagttaaacgtttgtatattgaacaa
ggttgcgatattcaaaaagaatattatgtaggttttgtaattgaccgtgcaactgatcgt
attactttaatggcttcagaagaaggcggtactgaaattgaagaagtagctgctaaaaca
ccagaaaaaatctttaaagaaacaatcgacccagttgttggtttatcaccttatcaagcg
cgtcgtattgctttcaatattaatattccaaaagaatctattaataaagcagcgaaattc
ttaatttctttatacaatgtatttatcgaaaaagattgttctatcgttgaaattaaccca
ttagttactactggtgaaggtgaagttttagctttagatgctaaaatcaacttcgatgac
aatgcattattcagacataaagatatccaagaattacgtgatttagaagaagaagatcct
aaagagattgaagcatctaaatatgacttatcttatattgcattagatggagatattggt
tgtatggttaatggtgctggtttagcgatggctacaatggatactattaatcattttggt
ggaaatccagctaacttcctagacgtagggggcggcgctacaaaagaaaaagttactgaa
gcattcaaaatcatcttaggtgatgacaatgttaaaggtatctttgtaaacattttcggt
ggaatcatgaaatgtgatgttattgctgaaggtatcgtagcagcagttaaagaagttgaa
ttaactttaccattagtagttcgtttagaaggtacaaatgtagaacgcggtaaagaaatc
ttaaacgaatcaggtttagcaattgaaccagcagctacaatggctgaaggcgctcaaaaa
attgttaagcttgttaaagaagcgtaa

DBGET integrated database retrieval system