KEGG   Staphylococcus haemolyticus JCSC1435: SH1714Help
Entry
SH1714            CDS       T00250                                 

Gene name
pyrB
Definition
(GenBank) aspartate transcarbamoylase chain A
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00240  Pyrimidine metabolism
sha00250  Alanine, aspartate and glutamate metabolism
sha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SH1714 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SH1714 (pyrB)
Enzymes [BR:sha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SH1714 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: BAE05023
NITE: SH1714
UniProt: Q4L5Q2
Position
complement(1775115..1776008)
Genome map
AA seq 297 aa AA seqDB search
MNNLLSMEHLSNEDIYELIQTACDYKSGKQTLPQFEGKFVSNLFFENSTRTKCSFEVAEQ
KLGLKEVNFETSTSSVQKGESLYDTCKTLESIGVDLLVIRHSQNAYYEELENLNIPIANA
GDGSGQHPTQSLLDIMTIYEEYGSFEGLNILICGDIKNSRVARSNFISLISLGANVMFSS
PDEWVDDSLDAPYVQIDDVIDQVDIVMLLRVQHERHGITGEANFEANDYHEQYGLTMDRY
NKLKDKAIVMHPAPVNRGVEIDSELVEAPKARIFKQMTNGMYLRMSVINKLLSGKEA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaataacttattatctatggaacatttatctaacgaggacatttacgaattaattcaa
acagcttgtgattacaaatcaggaaagcaaaccttaccacaattcgaagggaagtttgtt
tctaatttattcttcgaaaattcaactcgaacaaagtgtagctttgaagtagcagaacaa
aaattaggacttaaagaagttaattttgaaacaagtacttcatcagtacaaaaaggcgaa
tcactgtatgatacatgtaaaacacttgaaagtataggtgttgatttactagtaatcaga
cattctcaaaatgcatactatgaagaattagaaaatcttaatattccaattgctaatgct
ggagatggaagtggccaacatcctacacaaagtctgttagatattatgacaatctatgag
gaatacggttcttttgaaggattaaacattttaatatgtggtgatattaaaaattcacgt
gtagctcgaagtaattttataagtctaatttcattaggcgcaaatgtaatgttctcaagt
ccagatgaatgggtggacgactcattagatgcaccatatgttcaaattgatgatgtcatt
gaccaagtagatattgttatgttattacgtgttcaacatgaacgtcatggtattactgga
gaagctaattttgaggcaaatgattaccatgaacaatatggtttgacaatggatagatac
aataagttaaaagataaagcaatcgtaatgcaccctgcaccagttaacagaggagtagaa
atcgatagtgaattagttgaagcaccaaaggcacgaatctttaaacaaatgactaatggc
atgtatttaagaatgtcagtaatcaataaactattatcaggaaaagaggcgtaa

DBGET integrated database retrieval system