KEGG   Staphylococcus haemolyticus: SH2021Help
Entry
SH2021            CDS       T00250                                 

Gene name
dltA
Definition
D-alanine--poly(phosphoribitol) ligase subunit 1 (EC:6.1.1.13)
Orthology
K03367  
D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
sha  Staphylococcus haemolyticus
Pathway
D-Alanine metabolism
Staphylococcus aureus infection
Class
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:sha00473]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:sha05150]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2075041..2076498)
Genome map
AA seq 485 aa AA seqDB search
MTDIINLINDFGQSNPERVAVRHKDEELTYQQLMDESSKLAHLLQDNHKPLIVYGHMSPY
MLVGMIGAIKAGCGYVPIDTSVPSERVNMIINKVQPDIIFNTSDTQLNHSNIQELTIQSI
QDSDNPTLFDSQMGLTDVVYTIFTSGSTGEPKGVQIEYASLIEFAEWMVSLNESEGSQEW
LNQAPFSFDLSVMAIYPCLTSGGTLNLVDKEMINKPKLLNEMLVNTPINAWVSTPSFMEM
CLLLPNLNESSYPSLNHFFFCGEILPHRTAKALLDRYPSAVVYNTYGPTEATVAVTGIKL
TPEVIEAYNPLPVGVSRPNTSLFTTDEGELVIKGNSVSLGYLDNKEKTDAVFNFEDGLRI
YHTGDKAIEKDGQWFIQGRIDFQIKLNGYRMELEEIETQLRQSEFVRETVVVPVYKNNKV
IHLIGAVVPTEEVRDDLEMTRQIKSELKSRLPEYMIPRKFVWMKQLPLTSNGKLDRKQVA
EDINA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacagatatcataaatttaataaatgacttcggtcaaagtaatcctgaacgtgtagca
gttagacataaagatgaagaattaacatatcaacaattaatggatgaatctagtaaatta
gcgcatctattacaagataatcataagccgttaatcgtttatggacatatgtcaccttac
atgttagtaggaatgataggtgctatcaaagcaggttgtggctatgtacctattgacact
tcagtaccaagtgaacgtgtgaatatgattataaataaagtacaaccggacattatattt
aacacatcagatacacaattaaatcattccaatatacaagaacttacaattcaaagtatc
caagattctgataatccaacactatttgacagtcaaatgggattaacggatgttgtatat
actatttttacatctggttcaacaggtgagcctaaaggtgttcagatcgaatatgcaagt
ttaatagaatttgcagaatggatggtatcacttaatgaatcagaaggttcacaagagtgg
ttaaatcaagcaccattctcgttcgatttatcagtcatggcaatttatccttgtttaaca
tcaggtggcacacttaatttagtagataaagaaatgatcaataaacctaaattactcaat
gaaatgttagttaatacaccaatcaatgcatgggtatctacaccatcatttatggaaatg
tgcttgctattacctaaccttaacgaatcaagttacccaagcttgaatcatttcttcttc
tgtggagaaatcttacctcatagaactgcgaaagcacttttagatagatatccaagtgca
gtggtttataacacgtatggacctacggaagcgacagtagctgttacaggtattaaattg
acacctgaagtaattgaagcttataacccgctacctgttggtgtttcaagacctaacaca
tcattgtttacaacagacgaaggcgaacttgttattaaaggtaatagtgttagtcttggg
tatttagataacaaagaaaaaaccgatgcggtatttaactttgaagatggacttcgtata
tatcatacgggtgataaagccatcgagaaagatggacaatggttcattcaaggaagaatt
gatttccaaattaaacttaacggttaccgaatggaattggaagaaattgaaacgcaactt
agacaatcagagtttgttagagaaactgttgtcgttccagtatataaaaataataaagta
atacatttaatcggtgctgtcgttccgactgaagaagttagagatgatttagaaatgaca
agacaaattaaatctgaactaaaatctcgcttacctgaatatatgattccgagaaaattt
gtttggatgaaacagttaccattaacgtcaaacggaaagcttgatcgtaaacaagtcgca
gaggatattaacgcatga

DBGET integrated database retrieval system