KEGG   Staphylococcus haemolyticus JCSC1435: SH2106Help
Entry
SH2106            CDS       T00250                                 

Definition
(GenBank) unnamed protein product; carboxyesterase precursor homologue
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Brite
Enzymes [BR:sha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SH2106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Peptidase_S9 DLH Abhydrolase_6 DUF2048 BAAT_C PhoPQ_related Esterase FSH1 Abhydrolase_3 Abhydrolase_5 DUF4611 Chlorophyllase Ser_hydrolase
Motif
Other DBs
NCBI-ProteinID: BAE05415
NITE: SH2106
UniProt: Q4L4L0
Position
complement(2137459..2138199)
Genome map
AA seq 246 aa AA seqDB search
MQIKLPQPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LKSSPHVWFKDVIDGYDYLVDQGYEEIAVAGLSLGGVFALKLSLNRPVKGIITMCAPAEG
KTQGAIYEGFLEYARNFKKYEGKDQATIDKEMEDFHPTETLKELSETLNNVRNEIDEVLD
PILVVQAENDEMINPQSANYIYENVDSDEKDIKWYANSGHVITIDKEKEQVFEDVYSFLE
TLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaaattaccacaaccgtttttctttgaggaaggaaaacgagcagtcttactt
ctacatggatttacaggtaattcatcagacgtaagacaattaggaagattcctacagaag
aaaggttacacttcttatgcgcctcaatatgaagggcatgctgcaccacctgaagaaatt
ctaaaatcaagcccacatgtgtggtttaaagatgtgattgatggttatgattatttagtg
gaccaaggctatgaagaaattgccgtagcaggcttatctcttggtggtgtattcgcattg
aaattgagcttaaatcgtcctgtaaagggtattataactatgtgtgcacccgctgaaggt
aaaacgcaaggtgcgatatacgaaggctttttagaatatgcacgaaacttcaaaaaatat
gaaggcaaagatcaagcaacgattgataaagaaatggaagacttccatcctactgaaacg
ttaaaagagttaagcgaaacattaaataacgttagaaacgaaatcgatgaagtgttagat
ccaattttagtagtacaagctgaaaatgatgaaatgattaatcctcaatcagcaaattat
atatacgagaatgtcgactcagatgaaaaagacatcaaatggtatgcaaattcaggacat
gtcattacaatcgataaagaaaaagaacaagtattcgaagatgtatacagtttcttagaa
actttagattggtctgaataa

DBGET integrated database retrieval system