KEGG   Staphylococcus haemolyticus: SH2106Help
Entry
SH2106            CDS       T00250                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sha  Staphylococcus haemolyticus
Brite
Enzymes [BR:sha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SH2106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2137459..2138199)
Genome map
AA seq 246 aa AA seqDB search
MQIKLPQPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LKSSPHVWFKDVIDGYDYLVDQGYEEIAVAGLSLGGVFALKLSLNRPVKGIITMCAPAEG
KTQGAIYEGFLEYARNFKKYEGKDQATIDKEMEDFHPTETLKELSETLNNVRNEIDEVLD
PILVVQAENDEMINPQSANYIYENVDSDEKDIKWYANSGHVITIDKEKEQVFEDVYSFLE
TLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaaattaccacaaccgtttttctttgaggaaggaaaacgagcagtcttactt
ctacatggatttacaggtaattcatcagacgtaagacaattaggaagattcctacagaag
aaaggttacacttcttatgcgcctcaatatgaagggcatgctgcaccacctgaagaaatt
ctaaaatcaagcccacatgtgtggtttaaagatgtgattgatggttatgattatttagtg
gaccaaggctatgaagaaattgccgtagcaggcttatctcttggtggtgtattcgcattg
aaattgagcttaaatcgtcctgtaaagggtattataactatgtgtgcacccgctgaaggt
aaaacgcaaggtgcgatatacgaaggctttttagaatatgcacgaaacttcaaaaaatat
gaaggcaaagatcaagcaacgattgataaagaaatggaagacttccatcctactgaaacg
ttaaaagagttaagcgaaacattaaataacgttagaaacgaaatcgatgaagtgttagat
ccaattttagtagtacaagctgaaaatgatgaaatgattaatcctcaatcagcaaattat
atatacgagaatgtcgactcagatgaaaaagacatcaaatggtatgcaaattcaggacat
gtcattacaatcgataaagaaaaagaacaagtattcgaagatgtatacagtttcttagaa
actttagattggtctgaataa

DBGET integrated database retrieval system