KEGG   Staphylococcus haemolyticus JCSC1435: SH2111Help
Entry
SH2111            CDS       T00250                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00010  Glycolysis / Gluconeogenesis
sha00051  Fructose and mannose metabolism
sha00562  Inositol phosphate metabolism
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
sha01120  Microbial metabolism in diverse environments
sha01130  Biosynthesis of antibiotics
sha01200  Carbon metabolism
sha01230  Biosynthesis of amino acids
Module
sha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sha_M00002  Glycolysis, core module involving three-carbon compounds
sha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SH2111 (tpiA)
   00051 Fructose and mannose metabolism
    SH2111 (tpiA)
   00562 Inositol phosphate metabolism
    SH2111 (tpiA)
Enzymes [BR:sha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SH2111 (tpiA)
Exosome [BR:sha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SH2111 (tpiA)
  Exosomal proteins of bladder cancer cells
   SH2111 (tpiA)
  Exosomal proteins of melanoma cells
   SH2111 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAE05420
NITE: SH2111
UniProt: Q4L4K5
Position
complement(2142440..2143201)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTVKEAKDFVNNLPTLPDEKEVESVICAPTIQLDALISLVNDGKAKG
LKIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEDVNKKAHAVFN
HGMTPIICVGETDEERENGKANEIVSNQVEKALEGLSEEQLKEVVIAYEPIWAIGTGKSA
TSDDANEMCAHVRKTVAKVASQDVADATRIQYGGSVKPNNVKEYMAQSDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaatcatagctggtaactggaaaatgaacaaaacagttaaagaagctaaa
gacttcgttaataatttaccaacattacctgatgaaaaagaagttgaatcagtaatttgt
gcaccaacaattcaattagatgcactaatttcattagtgaatgatggcaaagcaaaagga
ttaaaaattggtgctcaaaacacttattttgaagataatggtgcattcacaggagaaact
tctccagtggcattagctgacttaggtgttaaatacgtagttattggacactcagaacgt
cgtgaattattccatgaaacagatgaagatgtgaataaaaaagcacatgcggtatttaat
catggcatgacaccaattatttgtgttggtgaaacagatgaagaacgcgaaaatggcaaa
gctaatgaaatcgttagcaatcaagttgaaaaagcattagaaggtttatcagaagagcaa
cttaaagaagttgttattgcatacgaaccaatttgggcaatcggtactggtaaatcagct
acttctgatgatgctaatgaaatgtgtgctcacgtgcgtaaaacagtagcgaaagtggct
agtcaagatgttgctgacgcaacacgtattcaatacggtggtagtgttaaacctaacaac
gttaaagaatacatggctcaatctgacattgatggtgcattagtaggtggcgcatcatta
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system