KEGG   Staphylococcus haemolyticus JCSC1435: SH2494Help
Entry
SH2494            CDS       T00250                                 

Gene name
folK
Definition
(GenBank) 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00790  Folate biosynthesis
sha01100  Metabolic pathways
Module
sha_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SH2494 (folK)
Enzymes [BR:sha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SH2494 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: BAE05803
NITE: SH2494
UniProt: Q4L3H4
Position
complement(2503502..2503981)
Genome map
AA seq 159 aa AA seqDB search
MVQAYLGLGSNIGDREQQLQEAIKIIDSIEGITVTKISPIYETAPVGYTEQPNFLNLCLE
IDTELEPKELLKYCLETEQRLHRVRDIRWGPRTLDVDILLYGDKVIEEDDLEVPHPRMSE
RAFVLIPLNDIAPTQIEPRSKTRISDLVIPDDTVKKYKG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggtacaagcgtatttaggtttaggaagcaatattggtgatagggaacagcaattacaa
gaagctattaaaataattgacagtattgaaggcattactgtgactaaaatctctccaata
tatgaaactgcaccagtagggtataccgagcagcctaattttttaaatttgtgtttagaa
attgatacagaattggagcctaaagaacttcttaaatattgcttagaaaccgaacaacga
ttacaccgagttagagacattcgttggggtccaagaacattagatgtcgatattttatta
tatggggataaggttatagaagaagatgaccttgaagttccccatccgcgaatgagtgaa
cgtgcttttgtgctaataccattaaatgatattgcaccaacacaaattgaacctcgttca
aaaactcgtatctctgatttagtcataccagatgacacagtgaagaaatataaaggttaa

DBGET integrated database retrieval system