KEGG   Staphylococcus haemolyticus JCSC1435: SH2516Help
Entry
SH2516            CDS       T00250                                 

Definition
(GenBank) unnamed protein product; hypothetical protein, similar to 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00900  Terpenoid backbone biosynthesis
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
sha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SH2516
Enzymes [BR:sha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SH2516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAE05825
NITE: SH2516
UniProt: Q4L3F2
Position
complement(2525428..2526276)
Genome map
AA seq 282 aa AA seqDB search
MIYETAPAKINLTLDTLFKRDDGYHEIAMIMTTVDLNDRLSFQKRKDKKIVVDIEHNYVP
NDHKNLAYRAAQLMMETYDLNEGVTITIDKDIPVSAGLAGGSADAAATMRGINRLFNLDK
SLHELSDLGIQIGTDIPFCIYNRTAVCKGRGEKIRFLKKPPSAWVVLAKPNLGISSADVF
KALDLDDAHHVDTEMCEKAIVEGDYKQLCESLSNRLEPVSMSMHPEIKKIKNNMLQCGAD
GALMSGSGPTVYGLAQKESQAKKIYNAVNGCCNEVYLVRLLG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgaaacggcaccagccaagataaatttgacgctcgatacacttttcaaaaga
gatgatggatatcatgaaattgcaatgattatgacgacagttgatctgaacgatcgatta
tctttccaaaaaagaaaagataaaaaaatcgttgttgatattgaacataactatgttcca
aatgatcataaaaatttggcttatcgtgcagcacaattgatgatggaaacctatgattta
aatgaaggtgtcaccattactatagataaagatattcctgtatctgccggtttagcagga
ggatcagctgatgcagctgctacgatgcgtggtattaatcggctgtttaatttggataaa
tctttgcatgaactaagtgatttgggaatacaaattggaacagacattccgttttgcatc
tataacagaactgctgtatgcaaaggtagaggtgaaaagatacgctttttaaagaagcca
ccttcagcttgggtagttttagcgaaacctaatttaggtatatcatccgcggatgtattc
aaggcgttagatttggatgatgcacatcatgtagatacagaaatgtgcgagaaggcgatt
gttgaaggtgattataaacagttatgtgaaagcttatcgaatcgtctagaaccagtatca
atgtcaatgcatcctgaaattaaaaaaataaaaaataatatgttgcaatgtggtgcagat
ggcgcattaatgagtggtagtggtccaaccgtatatgggcttgctcaaaaagaaagccaa
gcgaaaaagatatataatgctgttaatggctgctgtaatgaagtgtatttagtaagatta
ttaggatag

DBGET integrated database retrieval system