KEGG   Staphylococcus haemolyticus: SH2654Help
Entry
SH2654            CDS       T00250                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sha  Staphylococcus haemolyticus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SH2654
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SH2654
Enzymes [BR:sha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SH2654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2659910..2661634
Genome map
AA seq 574 aa AA seqDB search
MARVDLKAKPYFLNDEQIQWVEETLSHLTDEEKIGQLFFNLFSLEEDGDFNDSEYTNKDI
LNRYHIGGARYQGGNKQQVQALLNDLQQHSKVPLLVAANCDSGGNGACKDGTYIASAAQC
EAAQDSKVAYNAGYVSGRESQALGVNINFDPCVDILKNWRNTIVNTRAYGTTAETVIKYT
NAFINGFNETQDMITCIKHFPGDGTEERDQHLVLGVNEMTTDEWDQSFRKVYENHINNGV
EMIMSGHIALPHYSKKLNPELADKDILPATLSKELITDLLKDDLAFNGLVVTDASHMLGM
TAAMKREDYVPQAIAAGCDMFLFFNDLEEDFHFMLKGYQDGVITDDRLNDAVRRILGLKA
KIHLPKKQAQGTLLKNEDQLSVIGCDEHLTMQQEAADLSITLVKNTLDQLPIRPETHKNI
RLYIIEGEKNGIYKSDDTVEHNLVSILEDRGFNVTVNDGSTRVKGKTLEYRDNVDAALVF
ANIVGYAAENNYRIRWSTAMSNEIPWYVHEVPTVFTSLNFTTHLHDATMVKAYINAYHSN
KTTLETVVDKIMGESDFKGVPNDLVWTDKWQAKL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcacgagtagatttgaaagctaaaccttactttttaaatgacgaacaaattcaatgg
gttgaagagacattgtcacatttaactgatgaagaaaaaataggacaattattctttaat
ttattttcattagaagaagatggcgactttaacgattctgagtatacaaataaagatatt
ttaaatcgatatcatatcggtggtgcccgctatcaaggcggaaacaagcaacaagttcaa
gcgctattaaacgatttacaacaacatagtaaagtgcctttacttgtcgctgcaaactgt
gactctggtggcaatggagcttgtaaagatggtacgtatatcgcttcagcagctcagtgt
gaagccgctcaagacagtaaagtcgcttataatgcaggttacgtatctggtcgagaatca
caagcacttggcgttaacattaactttgacccttgcgttgatattttaaaaaattggcgt
aacacaattgtgaacacacgtgcatatggaacaactgcagaaaccgtgattaaatatacc
aatgcctttattaatggctttaacgaaacacaagatatgatcacttgtattaaacatttc
ccgggtgacggtactgaagaacgcgatcaacaccttgtattaggtgtaaatgaaatgaca
acagatgaatgggatcaaagtttccgaaaagtctatgaaaatcacattaataatggggtg
gaaatgatcatgtcaggtcatatcgcattacctcattattctaaaaaactcaatcctgag
ttagcagacaaagacattttaccagcaacattatctaaagaattaattaccgatttatta
aaagacgacttagcttttaatggcttagtcgtaacagacgcaagtcatatgttaggtatg
actgcagccatgaaacgtgaagactatgtgcctcaagcgattgctgccggttgcgatatg
ttcttattcttcaatgatttagaagaagacttccacttcatgttaaaaggttatcaagac
ggcgtgatcactgacgaccgtctaaatgatgctgtaagacgtattctaggactaaaagct
aaaatacatttacctaaaaagcaagcacagggtacactacttaaaaatgaagaccaactt
agcgttatcggttgtgatgaacacttgacaatgcaacaagaagctgccgatttaagcatc
acattagtgaagaacacattagatcaattaccaatacgccctgaaacacacaagaatata
cgcttgtatattatcgaaggtgagaaaaatggtatttacaaatcagatgacactgtcgaa
cataacttagtatctatcctagaagatcgtggatttaatgtgacagttaatgatggctct
acacgtgtaaaaggtaaaacattagaatatcgtgataacgttgatgctgcactcgtattc
gcaaatatcgttggatacgctgctgaaaataactatcgcatccgatggtcaactgcaatg
agtaacgaaattccatggtacgttcatgaagtgcctaccgtctttacatcactcaatttc
acaacacacttacatgatgcaacaatggtcaaagcctatatcaacgcgtaccattcaaat
aaaacaacattagaaaccgttgtcgataaaatcatgggcgagtcagatttcaaaggcgtg
ccaaatgatttagtctggacagataaatggcaagctaaattataa

DBGET integrated database retrieval system