KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_01364Help
Entry
SU5_01364         CDS       T02011                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SU5_01364
Enzymes [BR:shb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SU5_01364
Peptidases [BR:shb01002]
 Cysteine Peptidases
  Family C44
   SU5_01364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1520833..1522497)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAAELRKKALELSRLMRHRGPDWSGIYACDNAILAHERLSIVDVNAGA
QPLYNARKTHVLAVNGEIYNHQTLRAEYGDCYAFQTGSDCEVILALYQEKGPDFLDDLQG
MFAFALYDSEKDAYLIGRDHIGIIPLYMGYDEFGNFYVASEMKALTPVCRTIKEFPAGSY
LWSKDGEIRQYYQRDWFDYDAVKDNVTDKNALRQALEESVKSHLMSDVPYGVLLSGGLDS
SIISAITKKFAARRVEDQERSEAWWPQLHSFAVGLEGSPDLKAAQEVASHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLQALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHVLRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAKQISDQQLET
ARFRFPYNTPSSKEAYLYREIFEELFPVPSAAECVPGGPSVACSSAKAIEWDEAFKTMDD
PSGRAVGVHQSAYQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggcgtattcgatatcaaaacagatgcagcggaactgcgtaaaaaa
gcccttgaactgtcacgcctgatgcgccatcgcggcccggactggtccggcatctacgct
tgcgataacgcgattcttgcacatgaacgtttgtcgattgttgatgttaacgccggcgcc
cagcccctgtataacgccagaaaaacccacgtgctggcggtgaacggtgaaatttataac
catcaaacgttacgcgcggagtatggcgattgttacgcgttccagacaggctccgactgc
gaagttattctcgcgctatatcaggaaaaagggccggatttccttgacgatttacagggg
atgttcgccttcgccctgtatgacagcgaaaaagacgcttatctgattggtcgtgaccat
atcggtattattccgctctacatgggctatgacgaattcggcaacttctacgtagcgtca
gaaatgaaagcgctgaccccggtctgccgcaccattaaagagttcccggcgggcagctac
ctgtggagcaaagacggcgaaattcgtcagtactatcagcgcgactggttcgattacgat
gcggtaaaagacaacgtcaccgacaaaaacgcgctgcgtcaggcgctggaagaatccgtg
aaaagccacctgatgtccgacgtcccttacggcgtgctgctctccggcggtctggactcg
tcgattatctcggctatcaccaaaaaattcgccgcccgtcgcgtcgaagatcaggagcgc
tccgaagcctggtggccacagttgcactcttttgcggtcggtctggaaggttcgcctgac
ctgaaggcggcccaggaagtggctagccacctcggcaccgtgcaccatgaaattcacttc
accgtgcaggaaggccttgatgccattcgtgatgttatctatcacattgaaacctatgac
gtgaccactatccgcgcctcaacgccgatgtatctgatgtcgcgtaagatcaaagcgatg
ggcatcaaaatggtgctctccggcgaaggttccgatgaggtgtttggcggctacctgtac
ttccataaagcgccgaacgccaaagagttacatgaagagacggtccgtaagctacaggcg
ctgcatatgtatgactgcgcccgcgccaacaaagcgatgtccgcctggggcgtggaagcg
cgcgtaccgttcctggataaaaaattcctcgacgtggcgatgcgtatcaacccacaggat
aaaatgtgcggcaacggcaagatggaaaaacacgtgctgcgcgagtgcttcgagtcttat
ctgccagcaagcgtcgcgtggcgtcagaaagagcaattctctgacggcgtaggttacagc
tggattgatacgctgaaagaggtggcggcgaaacagatttccgatcaacaactggaaacc
gcccgcttccgctttccatacaacacgccgtcgtctaaagaggcgtacttgtaccgggaa
atttttgaagaattgttcccggtgccgagcgccgcggaatgcgtacccggcggcccgtcc
gtggcctgttcttccgccaaagccattgagtgggatgaagcattcaaaacgatggatgac
ccgtcaggccgcgcggtcggcgtgcatcagtcggcgtaccagtaa

DBGET integrated database retrieval system