KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_01412Help
Entry
SU5_01412         CDS       T02011                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00020  Citrate cycle (TCA cycle)
shb00190  Oxidative phosphorylation
shb00650  Butanoate metabolism
shb01100  Metabolic pathways
shb01110  Biosynthesis of secondary metabolites
shb01120  Microbial metabolism in diverse environments
shb01130  Biosynthesis of antibiotics
shb01200  Carbon metabolism
Module
shb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
shb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SU5_01412
   00650 Butanoate metabolism
    SU5_01412
  Energy metabolism
   00190 Oxidative phosphorylation
    SU5_01412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFH44775
Position
1580263..1580610
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEAWTGFFSSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLAVRLILQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgacttcatcctggtccgt
gctaccgctatcgttctgacgttatacatcatctacatggtgggttttttcgccacgagc
ggcgaactgacctttgaagcctggaccggtttcttctcatcggccttcaccaaagtcttc
accctgctggcgcttttttccatcttgattcatgcctggatcggcatgtggcaggtgtta
accgactacgttaaaccactggcagtgcgtctgatactgcaactcgttatcgttgttgcg
ctggtggtttacgtcatctatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system