KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_01417Help
Entry
SU5_01417         CDS       T02011                                 

Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00020  Citrate cycle (TCA cycle)
shb00640  Propanoate metabolism
shb00660  C5-Branched dibasic acid metabolism
shb01100  Metabolic pathways
shb01110  Biosynthesis of secondary metabolites
shb01120  Microbial metabolism in diverse environments
shb01130  Biosynthesis of antibiotics
shb01200  Carbon metabolism
Module
shb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SU5_01417
   00640 Propanoate metabolism
    SU5_01417
   00660 C5-Branched dibasic acid metabolism
    SU5_01417
Enzymes [BR:shb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SU5_01417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFH44780
Position
1587799..1588965
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIGKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactttttgcccgctatggcttaccggcgccg
gtgggttatgcctgtactactccgcgtgaagccgaagaagccgcgtctaaaatcggcgct
ggcccgtgggtagtgaaatgtcaggttcacgctggcggccgcggcaaagcgggcggtgtg
aaggtagtaaaaagcaaagaagagattcgcgccttcgcggaaaactggctgggcaaacgt
ctggtgacctatcaaacagacgctaatggccaaccggtaaaccagattctggttgaagca
gcgaccgacatcggcaaagaactgtacctcggcgcggtggttgaccgtagttctcgtcgc
gtggtctttatggcgtctaccgaaggtggcgtagagatcgaaaaagttgcggaggaaacc
ccgcatctgatccataaagtcgcgctcgatccgctgaccggcccgatgccgtatcaggga
cgggagctggcgttcaaattgggtctggaaggtaaactggtgcagcagttcaccaaaatc
tttatgggcctggcaaccattttccttgagcgcgacctggcgctgatcgaaatcaacccg
ctggtgatcactaagcagggcgatctgatttgcctcgacggcaagctgggcgctgacggc
aacgcgctgttccgccagccggatctgcgcgaaatgcgcgaccagtctcaggaagacccg
cgtgaagcgcaggcggcgcagtgggaactgaactacgtcgcgctggacggcaacatcggt
tgcatggtgaacggcgcgggcctggcgatgggcaccatggacatcgttaagctgcatggc
ggcgaaccggctaacttccttgacgtaggcggcggcgcaaccaaagagcgcgtcaccgaa
gcgtttaaaattatcctctcggatgacaacgtgaaagcggttctggttaacatcttcggc
ggtatcgtccgttgtgacctgattgccgacggtatcatcggcgcggtggaagaagtgggc
gtgaacgttccggtggtggtgcgtctggaaggcaacaacgccgaactcggcgcgaagaaa
ctggctgacagtggcctgaatattattgcagcgaaaagtctgacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system