KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_01512Help
Entry
SU5_01512         CDS       T02011                                 

Definition
pyruvate formate-lyase activating enzyme (EC:1.97.1.4)
Orthology
K04069  
pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1693326..1694225)
Genome map
AA seq 299 aa AA seqDB search
MIFNIQRYSTHDGPGIRTVVFLKGCSLGCRWCQNPESRARAQDLLYDARLCLEGCDLCAQ
AAPDVIERALNGLLIHREKLTDAHFSVLAHCCPTQALTVCGEIKSVDEIMATVLRDKPFY
DRSGGGLTLSGGEPFMQPELAAELFKASHDAGIHTAVETCLHVPWKYIAPSLPYIDLFLA
DLKHVADGPFKQWTDGSASRVLENLRKLAAAGKKMVIRVPLIQGFNADEETIKAITDFAA
DELHVGEIHFLPYHTLGINKYHLLSQPYHAPDKPLDAPALLDFAQKYACQKGLTATLRG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcttcaatattcagcgctattctacccacgatggccccggtatccgtaccgtagta
tttctcaaaggctgttcgttgggctgtcgctggtgccagaacccggaaagccgcgcccgc
gctcaggatctgttatacgacgcgcggctgtgtctcgaaggatgcgacctgtgcgcgcaa
gccgcgccagacgtcattgagcgcgcgctaaacggcctgctcatccatcgcgagaaactg
accgacgcccatttttcagtcctggcgcattgctgccccacacaggcgttaaccgtgtgc
ggcgaaataaaaagcgtggatgagatcatggcgacggtactgcgcgataaacctttttac
gatcgcagcggcggcggtcttacgctttccggcggcgaaccgtttatgcagccggaactg
gcggcagagctgtttaaagccagccatgacgccggtattcatacagcggttgagacctgt
ctgcatgttccatggaaatacattgcgccctcactgccttatatcgatctgtttctggct
gatttgaagcatgtcgccgacgggccgtttaagcagtggaccgatggcagcgcctcgcgg
gtgctggaaaatctcaggaaactcgccgccgcgggcaaaaaaatggtgattcgcgtcccg
ctgattcagggatttaatgccgatgaggagaccattaaagccattaccgactttgccgcc
gacgaactgcacgtcggggaaattcattttctgccctaccacacgctgggcatcaataaa
taccacttactcagtcagccctatcatgccccggataaaccactggatgcgccggcgtta
cttgattttgcccagaagtacgcctgccaaaaaggtttaaccgcgaccctacgaggataa

DBGET integrated database retrieval system