KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_01661Help
Entry
SU5_01661         CDS       T02011                                 

Definition
Phage endolysin R
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Brite
Enzymes [BR:shb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SU5_01661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1850834..1851373
Genome map
AA seq 179 aa AA seqDB search
MAVRTKVKYGLSAAMLALIAAGASAPQLLDQFLQEREGNTLVAVRDNGGVWSVCRGVTRI
DGKPVVKGQRLTQSQCDHYNAIERDKALSWVNKHVHIPLTEPQKTGIASFCPYNIGPGKC
FPSTFYRKLNAGDRKGACAEIRRWIYDGGKDCHNRENQCYGQVIRRDQESALACWGIEQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcaggacaaaagttaaatacggtctttccgccgccatgctggcgctgattgcc
gccggtgccagcgcaccgcagctactcgaccagtttttacaggagcgggaaggaaatacg
ctggtggccgttcgtgataacggcggcgtctggtcagtatgccgtggcgtgacccgtatc
gatggtaaacccgtcgtgaaaggccagcgactgacacaaagccagtgcgaccattacaac
gccatcgagcgggataaagcgctgtcatgggtaaataaacatgttcatataccgctgact
gaaccgcagaaaaccggtattgcgtcgttctgtccgtataacatcggtcccggtaaatgt
tttccgtccacgttttaccggaagctcaacgcaggagatcgtaagggagcgtgtgcagaa
atccgccgttggatatatgacggcggcaaagactgccacaacagggaaaatcagtgttac
ggccaggtgatacgacgcgaccaggaatcggcgctggcgtgctggggtattgaacaataa

DBGET integrated database retrieval system