KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_01835Help
Entry
SU5_01835         CDS       T02011                                 

Definition
Beta N-acetyl-glucosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SU5_01835
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SU5_01835
Enzymes [BR:shb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SU5_01835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2028053..2029078
Genome map
AA seq 341 aa AA seqDB search
MGPVMLNVEGCELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRAASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFFALHGLEEGGRLAQEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHADPAKALAMATRFIDGMHDAGMKTTGKHFPGHGAVTADSHKETP
CDPRPETDIRGKDMSVFRTLISENKLDAIMPAHVIYRAIDPRPASGSPYWLKTVLRQELG
FDGVIFSDDLSMEGAAIMGSYAERAQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGSFSRRELMDSARWKTASAQLNQLHERWQEEKAGH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccagtaatgttgaatgtcgaaggatgtgagctggatgcggaggagcgcgagata
ctggcgcatccgctggttggcgggcttattctgttcacgcgtaattaccatgacccggaa
cagctgcgcgaattagtgcgccagattcgggcggcatcgcgtaaccatctggtggtggcc
gtcgatcaggaaggcgggcgcgtacagcgtttccgtgaagggtttacccgcctgcccgcg
gcgcaatctttttttgcgctgcatgggctggaagagggggggcgactggcgcaggaggca
gggtggctgatggccagcgaaatgatcgcgatggatattgatatcagttttgcgccagtg
ctggacgtcgggcatatcagcgcggcaattggcgagcgctcctatcatgccgatcccgca
aaagcgttggcaatggcaacgcgctttattgacggcatgcatgacgccgggatgaaaacg
accggtaagcatttccccggccacggcgcagtcacggcggactcccacaaagagacgccg
tgcgatccacgtcctgaaacggacatccgtggcaaagatatgtcggtgttccgcacgctg
attagcgagaataaactggatgcgattatgcctgcccacgtgatctaccgcgctatcgat
ccacgcccggcaagtggttcgccgtactggctgaaaacggtgctgcgtcaggagttaggc
tttgacggcgtcattttctccgacgatctgtctatggagggcgcggcgattatgggcagc
tatgctgagcgcgctcaggcgtcgctggatgcgggttgcgatatgattctggtctgcaat
aatcgtaaaggcgcagtcagcgtgctggataatctgtcgccgatcaaagcagaacgtgtt
acacgtttgtatcataaaggttcattttcacgccgggagctcatggactcagcacgctgg
aaaacagccagcgcccagctcaaccagttacatgaacgctggcaggaagaaaaagcaggt
cattaa

DBGET integrated database retrieval system