KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_01945Help
Entry
SU5_01945         CDS       T02011                                 

Definition
6-phosphofructokinase class II (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SU5_01945
   01230 Biosynthesis of amino acids
    SU5_01945
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SU5_01945
   00030 Pentose phosphate pathway
    SU5_01945
   00051 Fructose and mannose metabolism
    SU5_01945
   00052 Galactose metabolism
    SU5_01945
  Energy metabolism
   00680 Methane metabolism
    SU5_01945
Enzymes [BR:shb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SU5_01945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2141242..2142174)
Genome map
AA seq 310 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIAHLGGTATAIFP
AGGATGEHLVALLADENVPVSTVDAKDWTRQNLHVHVESSGEQYRFVMPGATLEDDEFRQ
LEEQVLEIESGAILVISGSLPPGVKVEKLTQLISAAQKQGIRCIIDSSGEALTAALALGD
IELVKPNLKELSALVNRDLTQPDDVRKAAQELVQSGKARRVVVSLGPQGALGIDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAQDASLEEMVRFGVAAGSAATLNQGTRLCSRDDT
QKIYAYLSAQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacgcttgcgccctctctcgatagcgcaacaatcacgccg
caaatttatcccgaaggtaaactgcggtgctccgcgccggtattcgaacccggcggcggg
ggtattaatgtcgctcgcgccattgcgcatcttggcggcaccgcgaccgccattttcccg
gctggcggcgctaccggcgaacatctggtcgcactactggctgatgaaaatgtccccgtg
tctaccgtcgatgcgaaggactggacgcgtcagaacctgcacgtccacgtcgagtccagc
ggcgaacagtatcgttttgttatgcccggcgccacgctggaagatgacgaatttcgccag
cttgaagaacaggtactggaaattgaatccggggcaattctggttatcagcggcagcctt
ccgcccggcgttaaggtcgagaaactcacgcaactgatttccgccgcgcagaagcaaggc
attcgctgcattattgatagctctggcgaggcgctcaccgccgcgctggcgcttggcgat
atcgaactggtaaaacctaacctgaaagaattgagcgcgttggtcaatcgcgatctgacg
cagcctgatgatgtgcgtaaagcggcccaggaattagtgcaaagcggcaaagctcgccgg
gtagtggtctctctggggccgcaaggggcgctgggcatagacagtgagaattgcatccag
gttgttcctcccccggtgaaaagtcaaagtactgtcggcgcaggcgacagtatggtaggc
gcgatgacgttaaaactggcgcaagacgcgtcgctggaagagatggtgcgcttcggtgtg
gcggcaggcagcgccgctacgctcaatcaaggtacgcgtctgtgttcccgtgacgatacc
caaaaaatatacgcctatctttccgcgcaataa

DBGET integrated database retrieval system