KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_02333Help
Entry
SU5_02333         CDS       T02011                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase / Phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shb01100  Metabolic pathways
shb01110  Biosynthesis of secondary metabolites
shb01130  Biosynthesis of antibiotics
shb01230  Biosynthesis of amino acids
Module
shb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SU5_02333
Enzymes [BR:shb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SU5_02333
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SU5_02333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AFH45690
Position
2559215..2560615
Genome map
AA seq 466 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIASIYQHYASAISVLTDEKYFQGSFDFLPIVSQSAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLSAVAHSLKMGVLTEVSNDEERERAIALGAKV
VGINNRDLRDLSIDLNRTRQLAPKLGHGVTVISESGINTYGQVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKVCGLTRAQDAKAACDAGAIYGGLIFVPSSPRAVSVEQAREVI
SGAPLQYVGVFQNADIADVCQKAAVLSLSAVQLHGSEDQAYVNALREALPRNVQIWKALS
VSDALPARDYHHVDKYIFDNGQGGSGQRFDWSLLRGQPLDDVLLAGGLAADNCVQAAQVG
CAGLDFNSGVESQPGIKDARLLASVFSDTARILRKKHDNTSQPLLW
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgcaaa
cagcaacagccgctggccagttttcaaaatgagatccagccaagtacacgccatttttat
gatgcgctccagggcgcgcgtaccgcctttattctggagtgtaagaaagcatcgccatca
aaaggcgtgattcgcgatgatttcgatccggcgcgtattgccagtatttatcaacattac
gcctcggcgatctcggtgctcaccgacgaaaaatattttcaggggagcttcgattttctg
ccgatcgttagccaaagcgcgccgcagccgattctgtgtaaggattttattatcgatccc
tatcagatctaccttgcccgttactatcaggccgatgcctgtttactgatgctctcggtt
ctggatgacgaacagtatcgccagctctccgccgtcgcgcacagtctgaaaatgggcgtg
ctcacggaggtcagtaatgacgaagaacgggagcgcgcgatagcgttaggcgcaaaagtg
gtaggtatcaacaatcgcgatctgcgcgatctgtcgattgatttgaatcgcacccgccag
ctggcgccaaaactgggccacggcgtgactgtcatcagcgagtccgggattaacacctat
ggtcaggtacgcgaactgagccacttcgccaacggttttttaattggctccgcgttaatg
gcgcatgacgatcttaacgccgccgtccgtcgcgtgctgcttggcgaaaataaagtctgc
ggtctgacccgcgcccaggacgccaaagctgcctgtgacgctggcgcaatatatggcggg
ttgatttttgtgccctcatctccgcgcgcggttagcgttgagcaggcgcgagaagtgata
agcggcgcgccattgcagtatgtcggcgttttccagaacgctgatatcgccgatgtttgc
cagaaagccgccgtcctgtcgctttctgccgtacagctacatggcagcgaagaccaggcg
tatgtcaacgcgctgcgcgaggcgttgccgcgcaatgtgcaaatctggaaggcgctgagc
gttagcgatgcccttcccgcacgcgattatcaccatgtcgataaatacattttcgacaat
gggcaaggcggcagcgggcagcgcttcgactggtcactgctacgggggcaaccgctggat
gatgtgttactggcgggcgggctggcggccgataactgcgtccaggcggcgcaagtcggc
tgtgccggtctcgattttaattcaggtgtggagtcacagccgggcatcaaagatgctcgt
cttctggcctcggttttttcagacactgcgcgcatattaaggaaaaaacatgacaacact
tctcaacccctactttggtga

DBGET integrated database retrieval system