KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_02334Help
Entry
SU5_02334         CDS       T02011                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00260  Glycine, serine and threonine metabolism
shb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shb01100  Metabolic pathways
shb01110  Biosynthesis of secondary metabolites
shb01130  Biosynthesis of antibiotics
shb01230  Biosynthesis of amino acids
Module
shb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SU5_02334
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SU5_02334
Enzymes [BR:shb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SU5_02334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFH45691
Structure
PDB: 

Jmol
Position
2560584..2561777
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKNYAGRPTALT
KCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGM
FADFINDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSI
SAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALK
MMREQPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacttctcaacccctactttggtgaattcggcggcatgtatgtgccgcagatc
ctgatgcctgcgctgaaccagcttgaagaggccttcgtcagcgcgcaaaaagatcctgaa
tttcaggcgcaattcgccgatctgctaaaaaactacgcaggacgccccaccgcactgacg
aaatgccagaacattaccgccggtacgcgtaccacgttgtatttaaagcgcgaagattta
ctgcacggcggcgcgcacaaaaccaatcaggtactgggtcaggcgctgctggccaaacgg
atggggaaaagcgagattatcgctgaaaccggcgccggtcagcacggcgtcgcctctgcg
ctcgccagcgccctgctgggtctgaaatgccgtatttatatgggcgccaaagacgttgag
cgccagtcgccgaacgtcttccgtatgcgtctgatgggcgctgaggtcatcccggttcat
agcggctccgctacgctaaaagatgcctgtaacgaggcgctgcgcgactggtccggtagt
tacgaaaccgcgcactatatgctcggcacggcggcaggaccgcatccctatcccaccatc
gttcgcgagttccagcgcatgattggcgaagagacgaaagcgcaaatcctcgacaaagag
ggccgtctgccagatgccgttatcgcttgcgtcggtggcggctcaaacgctatcgggatg
tttgccgattttattaatgataccagcgtcgggctaataggcgttgaacctggcggtcac
ggtattgaaaccggcgagcatggcgcgccgcttaaacatggtcgcgttggcatctatttc
gggatgaaagcgccgatgatgcaaacagcggacgggcaaattgaagagtcatattccatt
tccgccgggctcgatttcccatccgttgggccgcaacatgcgtacctgaacagcatcgga
cgcgcggattatgtctccattaccgatgatgaggcgctggaagccttcaaaacgttgtgc
cgccatgagggaattatcccggcgctggaatcctcccacgcgttggcgcacgctctgaaa
atgatgcgcgagcagccggaaaaagagcaactgctggtggtcaatctctctggccgcgga
gataaagacatctttaccgtacacgatatcctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system