KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_02528Help
Entry
SU5_02528         CDS       T02011                                 

Definition
Chemotaxis response regulator protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:shb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SU5_02528
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SU5_02528
Enzymes [BR:shb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SU5_02528
Two-component system [BR:shb02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   SU5_02528
Bacterial motility proteins [BR:shb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SU5_02528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(2749207..2750256)
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAARARIAAHKPMAAPATLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPAVIITQHMPPGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIAPGDKHMELARSG
ANYQIKIHDGPPVNRHRPSVDVLFHSVAKHAGRNAVGVILTGMGNDGAAGMLAMYQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagggtattgtcagttgatgattccgcgctaatgcgccaaatcatgact
gaaattattaatagccatagcgatatggagatggtggcgactgcgccggacccgttggtc
gccagggatctcatcaaaaaatttaatccggacgtattgaccctggacgttgagatgccg
cgtatggacggcctcgattttctggaaaaactgatgcgcctgcgaccgatgccggtggtg
atggtctcttcgctgaccgggaaaggttccgaagtgacgctacgggcgctggagttgggg
gccatcgattttgtcaccaaaccgcagcttggtattcgtgaaggtatgctggcgtatagc
gagatgatcgccgaaaaagtgcgtaccgccgcgcgggcccgcatcgccgcacataaaccg
atggcggccccggcaaccttaaaagccggtccgctgctcagttcggaaaaactgattgct
atcggcgcttcaacgggcggtactgaagctatccgacatgtgctgcaaccgctgccgctt
tccagtccggcagtgattattacgcagcatatgccgcctggctttacccgctcgtttgcc
gagcgcctgaataaactctgtcaaatcagcgttaaggaggccgaggacggcgaacgcgta
ttgccaggtcatgcctacattgcacccggcgacaagcatatggagctggcgcgtagcggg
gcgaattatcaaatcaaaattcatgatggcccgccggtaaaccggcatcgtccttccgtg
gatgtgctgtttcattcggtggcgaaacacgcggggcgcaacgccgtaggcgtcattctt
acggggatgggcaacgatggcgccgctggaatgttagcgatgtaccaggctggcgcctgg
accattgcgcaaaacgaagcaagttgtgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggcgtaagcgaagtggtcgatcttagccaggtaagccagcagatgctggcgaaa
atcagtgccggacaggcgatacgtatttga

DBGET integrated database retrieval system