KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0258Help
Entry
SU5_0258          CDS       T02011                                 

Definition
Malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:shb01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:shb00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:shb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
302412..304016
Genome map
AA seq 534 aa AA seqDB search
MMNPQATTTDELTFTRPQGELEKQVLTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDID
NGKLPDFISETTSIRESNWQIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFE
DSLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTW
RGEAIPGSLFDFALYFFHNYKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLP
RGTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQ
VVTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDVERNNQVLAKVKADKALEANN
GHDGTWIAHPGLADTAMAVFNEVLGEHKNQLFITRDEDAPITAEQLLEPCEGERTEAGMR
ANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKALF
REMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatccacaggcaaccacaactgatgaattaacctttaccaggccgcaaggcgag
ctggaaaagcaagtcctgaccgctgaagcagtcgagtttttgacggagttagtcacccgt
tttacgccaaaacgcaataaactcctggctgcacgtatccagcaacagcaggatattgat
aacggtaagttgcctgattttatttcggaaaccacttccattagagaaagtaattggcag
attcgtggtattccggcggatttacaggatcgccgagtagaaattaccgggccggttgaa
cgtaaaatggtgattaatgccctgaacgcaaatgtgaaagtgtttatggcggattttgaa
gactcgctggcgccggactggaataaagttattgatggtcaaatcaacctgcgtgatgcg
gtgaacggcaccattagctataccaacgaagccggaaaaatctatcagctcaagcccgat
ccggccgtattgatttgtcgtgtacgtggtctacatctgccagaaaaacatgttacctgg
cggggggaagccattcccggcagcctgtttgattttgctctgtactttttccacaactat
aaagcgctgctcgctaaaggtagcggcccgtatttttacctgccgaaaacgcaagcctgg
caggaggcagcctggtggagcgaagtcttcagctacgccgaagaccgctttaacctgccg
cgcggtacgatcaaagcgaccctgttgattgaaacgcttcctgctgttttccagatggat
gagattcttcatgcgttgcgtgatcatattgtcggtctcaactgtggtcgctgggattat
attttcagctatatcaaaacgttgaaaaatcacccggatcgcgtcctgccggacagacag
gtggtaacgatggacaaaccgtttctgagcgcctactcgcgcctgctgatcaaaacctgt
cacaagcgcggcgcgttcgcgatgggcggtatggcggcgtttatcccgagcaaagacgtt
gaacgcaacaatcaggtccttgccaaagtgaaagcggataaagcgctggaagcgaacaac
ggccacgacggcacgtggattgcgcatcccgggttggcggataccgcaatggccgtcttt
aacgaggtactgggcgagcacaaaaatcagctgttcattacccgtgatgaagatgcgccg
attaccgctgagcagttactggagccatgtgaaggcgaacgcacagaagcgggaatgcgc
gccaatattcgcgtggcagtgcagtacattgaagcgtggatctccggcaatggctgtgta
ccgatttacggtctgatggaggatgccgcgacggcggaaatctcacgaacctctatctgg
cagtggattcaccatgagaaaacactgagcaatggaaaacccgtaacgaaagcgcttttc
cgcgaaatgttggcggaagagatgcgggtaatccaggacgaactgggcgagcaccgctac
agcagcgggcgcttcgacgatgccgcacgtctgatggagcaaatcaccacctcagatgac
ttaatcgacttcctcaccctgccgggctatcgcttactggcttaa

DBGET integrated database retrieval system