KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_02983Help
Entry
SU5_02983         CDS       T02011                                 

Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00071  Fatty acid degradation
shb00280  Valine, leucine and isoleucine degradation
shb00281  Geraniol degradation
shb00310  Lysine degradation
shb00362  Benzoate degradation
shb00380  Tryptophan metabolism
shb00410  beta-Alanine metabolism
shb00640  Propanoate metabolism
shb00650  Butanoate metabolism
shb00903  Limonene and pinene degradation
shb00930  Caprolactam degradation
shb01040  Biosynthesis of unsaturated fatty acids
shb01100  Metabolic pathways
shb01110  Biosynthesis of secondary metabolites
shb01120  Microbial metabolism in diverse environments
shb01130  Biosynthesis of antibiotics
shb01200  Carbon metabolism
shb01212  Fatty acid metabolism
Module
shb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SU5_02983
   00650 Butanoate metabolism
    SU5_02983
  Lipid metabolism
   00071 Fatty acid degradation
    SU5_02983
   01040 Biosynthesis of unsaturated fatty acids
    SU5_02983
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SU5_02983
   00310 Lysine degradation
    SU5_02983
   00380 Tryptophan metabolism
    SU5_02983
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SU5_02983
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SU5_02983
   00281 Geraniol degradation
    SU5_02983
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SU5_02983
   00930 Caprolactam degradation
    SU5_02983
Enzymes [BR:shb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SU5_02983
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SU5_02983
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SU5_02983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AFH46322
Position
complement(3230973..3233120)
Genome map
AA seq 715 aa AA seqDB search
MTTTSAFMLNVRLDNVAVVAIDVPGEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISA
KADNFIAGADINMIGHCQNAQEAETLARQGQQLMAEIQALPVPVIAAIHGACLGGGLEMA
LACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQAL
KAGLVDDVVPQTILLEAAVELAKKERLAQRTLPVRERILAGPLGRALLFRLVRKKTAQKT
QGNYPATERIIDVIETGLAQGSSSGYDAEARAFGELAMTPQSQALRAVFFASTEVKKDPG
SDAPPGPLNSVGILGGGLMGGGIAWVTACKGGLPVRIKDINTQGINHALKYSWDLLETKV
RRRHIKASERDKQLALISGSTDYRGFSHRDLVIEAVFEDLPLKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAANAARPEQVIGLHFFSPVEKMPLVEVIPHASTSAQTIATTVKLAKKQ
GKTPIVVSDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVASILNDDRKGRKNGRGFYLYGEKGRKSKKQVDPA
IYKLIGVQGQSRLSAQQVAERCVMLMLNEAARCFDEKVIRSARDGDIGAVFGIGFPPFLG
GPFRYMDALGPGEMVATLQRLAALYGPRYAPCEQLVRMAERREHFWTNGETDQGN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgactaccacatcagcttttatgcttaacgtgcgtctggataatgtcgcggttgtcgct
attgatgtccctggagaaaaggtgaacaccctgaaagcggagtttgccgcgcaggtacgc
gccatcctgaagcagatccgggaaaataaagcgttgcagggcgttgtttttatctcagcc
aaagcagataactttattgctggcgctgatatcaacatgataggtcactgccaaaacgcg
caggaagcggaaacgctggcgcgtcaggggcaacaactgatggcggagatccaggcgttg
cctgttccggttatcgctgccattcacggcgcctgcctggggggcggtcttgaaatggcg
ctggcctgccatcggcgtatctgtaccgacgacgttaaaaccgttctcggactgccggag
gtacagttagggcttttaccgggatcgggcggaacgcagcgacttccacggctggtgggg
gtcagtaccgcgctggatatgatcctgacaggtaaacagcttcgcgccagacaggcgctt
aaagccgggctggttgatgatgtggtgccgcaaactattttactggaagcggctgtcgag
ctggctaaaaaagaacgcctggcgcagcggacattaccggtccgtgaacgtatcctggcg
gggccgctggggcgcgcgctgttatttcgcctggtgcgtaaaaagacagcgcaaaaaacg
cagggtaattatccggcgacggagcggatcattgatgtgattgaaaccggactggcgcag
ggcagcagtagcggctatgacgcggaagcgcgcgctttcggcgagctggcgatgacgcct
caatcgcaggcgctgcgcgctgttttctttgccagtaccgaggtgaaaaaagatcccggt
agcgatgcgccgcccggcccgctgaacagcgtgggcatcttaggcggcgggttaatgggc
ggcggtatcgcctgggttacggcctgtaaaggcggtttgccagtacgaattaaggatata
aatactcaggggatcaatcatgctctgaagtacagctgggatctgcttgaaacaaaagta
cgccgccgccatatcaaagccagcgaacgcgataaacagttggcgttgatatcaggttcg
accgattaccgtggtttcagtcatcgtgatctggtcattgaagcggtgtttgaagatctg
ccgttaaaacaacagatggtggcggaagtggagcaaaattgcgctgctcacaccattttt
gcctccaatacttcttccctgccgattggcgatattgcggcgaatgcggccagaccggaa
caggtgattggattgcacttttttagcccggtcgaaaaaatgccgctggttgaggttatt
cctcatgcgtctacttccgcgcagaccatcgccacgaccgttaagctggcgaaaaaacag
ggtaaaaccccgatagtcgtcagtgataaagccgggttttatgttaaccgaattcttgcg
ccgtatatcaatgaggcgattcggatgctgactgaaggcgaacgcgtcgaacatattgac
gccgccctggtaaaatttggttttccggtggggccaatccaacttttggatgaggtagga
atcgacacgggcactaaaattattcctgtgcttgaggcggcgtatggagaacgttttagc
gcgcctgcaaatgttgtcgcttcaattttgaatgacgatcgcaaaggtagaaaaaatggt
cgcggtttctatctttatggcgaaaaagggcgtaaaagcaaaaaacaggttgaccctgct
atttataagcttattggcgtgcaagggcagagtcgattgtctgcgcagcaggtggcagag
cgctgtgtcatgttaatgcttaacgaagcggcgcgctgtttcgacgaaaaagtgattcgc
agcgcgcgcgatggcgatatcggcgccgtgtttggtatcggttttccgccgtttctcggt
ggcccgttccgctatatggatgctctcgggccgggtgaaatggtggcgacattacagcgc
ctggccgcactttacggtcctcgttacgcgccttgtgaacaattagtgcgcatggcggag
cgcagggagcatttctggacgaatggggaaactgaccagggaaattga

DBGET integrated database retrieval system