KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_03010Help
Entry
SU5_03010         CDS       T02011                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SU5_03010
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SU5_03010
   00052 Galactose metabolism
    SU5_03010
   00500 Starch and sucrose metabolism
    SU5_03010
   00520 Amino sugar and nucleotide sugar metabolism
    SU5_03010
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SU5_03010
   00524 Butirosin and neomycin biosynthesis
    SU5_03010
Enzymes [BR:shb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SU5_03010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3264564..3265529)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVVRVYLDEHSVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDFAPNSEEEAMILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITERALADNCIDCRRALSLFCVI
MGRFGGDLALTMGTYGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKDYVHGIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggagatgtaggcggcacgaatgcgcgtcttgccctgtgt
gatatcgccagtggagaaatctcgcaggccaaaacgtattccggcctggattatcccagt
cttgaggccgtggtgcgcgtttatctcgatgagcatagcgtcagcgtggaagatggttgt
atcgccatagcctgtccgattaccggtgactgggtagcgatgactaaccatacctgggct
ttttctattgcggaaatgaaaaaaaatctcggctttagccatctggaaatcatcaacgat
ttcaccgccgtgtcgatggcgatcccgatgctgaaaaaagagcatttaattcagttcggc
ggcggcgaaccggtagacggcaaacctattgcggtgtatggcgcgggaaccggcttgggc
gtggcgcatctggtgcatgtggataagcgttggattagccttccgggcgaaggcgggcat
gtcgattttgcgcctaatagcgaagaagaagctatgattctggaaatattgcgcgccgaa
attggccacgtttccgccgagcgcgtgctgtctggcccggggctggtgaatctttaccgg
gcgattgttaagtccgacaaccgtctgccggagaatctgcgcccgaaagatattaccgaa
cgcgccctggcggataactgtatcgattgtcgccgcgcgttgtcgctcttttgcgtcatc
atggggcgatttggcggcgatctggcgttaaccatggggacatatggcggcgtttatatc
gctggcggtattgtcccgcgcttcctggaattttttaaagcgtctggcttccgtggtggc
tttgaagataaaggccgctttaaagattatgtacacggtattccggtctatctgattgtc
catgataaccctggcttgttaggctccggcgcgcatctgcgccagacattaggtcatatt
ctataa

DBGET integrated database retrieval system