KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_03466Help
Entry
SU5_03466         CDS       T02011                                 

Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SU5_03466
Enzymes [BR:shb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     SU5_03466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3800442..3802217
Genome map
AA seq 591 aa AA seqDB search
MKKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAVLITEKIRHACGAQVECVIADT
CIAGMAESAACEEKFSSQNVGVTITVTPCWCYGSETIDMDPMRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSV
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDQNASQYKRNEAQNRAVLKESLLMAMCIRDMMQGNKTLAGKGLVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEALLNSSFDWNGVREPFVVATENDSLNGVAMLFGHQLTGTAQIFA
DVRTYWSPEAVERVTGQALSGLAEHGIIHLINSGSAALDGACKQRDSEGKPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VELPKAMHDQLDARTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLAAMLRIPVCMHNVEEAKIYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagcttaccgaaaatcggtatccgcccggtgattgatggacgtcgtatg
ggcgtacgcgagtcgctcgaagagcaaaccatgaacatggcgaaagcgacggcggtgctc
atcaccgagaaaatccgccacgcctgtggggcacaggtggagtgcgtcattgcggatacc
tgtattgccggaatggcggaatccgccgcctgtgaagaaaaattcagtagccagaacgtg
ggcgtgaccattaccgttacgccgtgctggtgctatggcagcgaaaccattgatatggac
ccgatgcgtccgaaagccatctggggctttaacggcacagagcgtcctggggcggtttac
cttgccgcggcgctggcggcgcacagccagaaaggcattccggcgttctccatttatggc
catgacgtgcaggatgccgacgatacctccattcctgccgacgtcgaagaaaaactgctg
cgttttgcgcgggcagggttagcggtagccagtatgaaaggcaaaagctacctctccgtc
ggcggcgtgtcgatggggatcgcgggttccattgtcgatcataacttctttgaatcctgg
ctgggcatgaaggtgcaagcggtagatatgaccgagctgcgccgccgtatcgatcaaaaa
atttatgatgaggccgaactggagatggcgctggcgtgggcggataaaaacttccgctac
ggcgaagatcagaacgcctcgcagtataagcgcaatgaagcccagaaccgcgcggtgcta
aaagagagcctgctgatggcgatgtgtattcgcgatatgatgcagggcaacaagactctg
gcgggcaaagggttagttgaagaatcgctgggctacaacgccattgccgccggctttcag
ggccagcgccactggaccgatcaatacccgaacggcgataccgccgaagcgctgctcaat
agttcttttgactggaacggcgtacgcgaaccgtttgtcgtcgccaccgaaaatgacagt
ctgaacggcgtagcgatgctgtttggccatcaactcaccggtaccgcgcagatattcgcc
gacgtgcgaacctactggtcgccggaagccgtagaacgcgtcaccggccaggcgcttagc
ggactggcggagcacggcattattcacctgattaattccggttctgccgctctggacggt
gcctgtaaacagcgcgacagcgaaggcaagccgaccatgaaaccacactgggaaatcagc
caacaagaggcggatgcgtgtctggcggccaccgaatggtgcccggcgattcacgaatac
ttccgcggcggcggctactcatcccgtttcctgaccgaaggcggcgtgccattcaccatg
acccgcgtgaatatcatcaaaggtctgggaccagtactgcaaatcgccgagggctggagc
gtcgaactgccgaaagcgatgcacgatcagcttgatgcccgcaccaactctacctggcct
actacctggtttgcgccgcgtcttaccggcaaaggcccgtttaccgatgtctattcggtg
atggcgaactggggcgctaaccacggcgtactcaccatcggccatgtaggggcagacttt
attactctcgccgcgatgctgcgtatcccggtatgtatgcacaacgtggaggaggcgaag
atctaccgtccttccgcctgggcggctcacggtatggatatcgaaggccaggattatcgc
gcctgccagaattatggcccgctgtataaacgttaa

DBGET integrated database retrieval system