KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_03481Help
Entry
SU5_03481         CDS       T02011                                 

Definition
Exodeoxyribonuclease V alpha chain (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:shb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SU5_03481
Enzymes [BR:shb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SU5_03481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3816497..3818332)
Genome map
AA seq 611 aa AA seqDB search
MTIQERLLEAVEQKLLRPIDAQFALTVAGNDDPAVTLAAALLSHDAGEGHVCLPLSRLTL
TEEAHPLLVAWISETPTPIDWKKRLLASAAVSCGDSPAPLILCGDRLYLNRMWCNERTVA
RFFNEVNQAIAVDEDQLSRILDALFPPTDEVNWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGAALRQLPLTDAQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPPHGRVIFLGDRDQ
LASVEAGAVLGDICAYVNAGFTAERARQLSRLTGSAIPAGAGTQAASLRDSLCLLQKSYR
FGSDSGIGKLAAAINCGDRSAIQAVFQQGFSDIEKRTLQSSDDYAGMLDEALAGYGRYLR
LLHEKATPEAILQAFNEYQLLCALREGPFGVRGLNDRIEQAMVQQRKIQRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGLRVWFVMPDGTIKSVQPSRLPEHDTTWAMTVHK
SQGSEFDHAALILPSQRSPVVTRELVYTAVTRARRRLSLYADERILAGAIVTRTERRSGL
ATLFDEVSRTE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccaggagcggttgctggaggccgttgaacaaaaactcttacggcccattgat
gcccagtttgctttaaccgtcgccggtaacgacgatcccgccgtgacgctggcggcagcg
ctgcttagtcatgacgcaggtgaaggtcacgtgtgtctgccgttgtcgcgtttaacgtta
acggaggaggcgcatcccttactggtcgcctggataagcgaaacgcctacgccaatcgac
tggaaaaagcggttactggcgtctgcggcggttagctgcggcgatagccccgcgccgtta
attctgtgcggcgatcgtctctacctgaatcgtatgtggtgcaacgagcgtacggttgcg
cgcttttttaacgaggttaaccaggccatcgccgtagatgaagatcagttatcccgtatt
ctggacgcgctattccctccgacagacgaggtgaactggcaaaaggtggccgccgccgta
gcgctaactcgccgtatctccgtgatttcaggcggtcccggcaccggtaaaaccaccacc
gtcgcgaagctgctggcggcattaattcaaatggcggatggcgaacgttgccgtatccgg
ctggcagcgccgaccgggaaagcggccgcacgcctgacggagtcgctcggcgcggcgttg
cgtcagcttccacttaccgatgcgcagaaaaagcgtataccggaggacgccagtacgctg
caccgactgctaggcgcacagcccggcagccagcgattacgccatcatgcgggcaacccg
ctacatctggacgtgctggtggtcgatgaagcatcaatgattgatttgccgatgatgtca
cgtttgattgacgctctgccgccgcacgggcgggtcatttttcttggcgatcgcgatcag
ttggcatccgttgaggcgggcgctgtgttgggcgatatttgcgcctatgtcaacgcaggg
tttacggcggaacgcgcccgacagctaagtcgactcactggtagcgccattccggcgggg
gccggaacgcaagccgcatctttacgcgatagcctctgtttgttgcaaaagagctatcgt
ttcggcagcgattctggcatcggcaagctggcggcggcaattaactgcggcgacaggtcg
gcaatccaggctgtttttcagcaggggtttagcgatatagagaagcgtacattgcaaagt
agcgacgattatgccgggatgctggatgaagcgctggcgggctatggtcgctacctgcgg
ttgctgcatgaaaaagcgacgccggaggcaatcctgcaggctttcaatgagtatcaactg
ctttgcgcgctgcgcgaaggcccatttggcgtgaggggattgaatgaccgcattgagcag
gcgatggtgcagcaacgaaaaattcagcggcatccgcactctcgctggtatgaagggcgt
ccggtaatgattgcgcgcaacgatagcgcgctggggttatttaatggcgatattggtatt
gcgctcgatcgcggacaggggttacgcgtctggtttgtgatgccggatggcacgatcaag
tccgttcagcccagccgtctgccggaacatgatacaacctgggcgatgacggtacataaa
tcacaggggtctgaatttgatcacgccgcgctgattttacccagccaacgttcgccggtc
gtgacgcgggagctggtgtataccgcggttacgcgggcgcggcggcggttatcgctgtat
gccgatgaacggatcctggcaggcgcgattgtgacgcgaacggaacggcgcagcgggtta
gccaccttatttgatgaagtcagtcgtaccgaataa

DBGET integrated database retrieval system