KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_04013Help
Entry
SU5_04013         CDS       T02011                                 

Definition
(GenBank) 1,4-alpha-glucan (glycogen) branching enzyme, GH-13-type
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00500  Starch and sucrose metabolism
shb01100  Metabolic pathways
shb01110  Biosynthesis of secondary metabolites
Module
shb_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SU5_04013
Enzymes [BR:shb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SU5_04013
Exosome [BR:shb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SU5_04013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 Malt_amylase_C AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: AFH47335
Position
complement(4377479..4379665)
Genome map
AA seq 728 aa AA seqDB search
MSSRIDRDVINALIAGHFADPFSVLGMHQTQAGLEVRALLPDATDVWVIEPKTGRKVGKL
ECLDARGFFCGVLPRRKNFFRYQLAVTWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKFELLDANGNLRIKADPYAFEAQMRPETASMICGLPEKVTPGEERQKANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPSDEFSLAEFDGTHLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWMERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRIIGEQVPGAVSMAEESTDFSGVTRPPETGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHDKLTFGMLYNHTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDAYGFEWLVVDDNERSVLIFVRRDKAGNEIIVASNFTPV
PRHDYRFGINQPGRWREILNTDSMHYHGSNTGNGGVVHSDEIESHGRQHSLNLTLPPLAT
IWLMREGE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtcgtatcgatagagacgtgattaatgcgctaattgcaggacattttgcggac
cctttttccgtactcggaatgcaccagacccaagccggactagaagtccgcgccctctta
cctgacgccaccgacgtatgggtgattgagcccaaaaccggacgtaaagtcggcaaactg
gaatgtctcgacgctcgcggttttttctgcggcgttttaccccgacgtaaaaatttcttt
cgctatcagctcgccgtgacctggcacggacagcagaacctcatcgacgatccttaccgt
tttggtccattaatacaggaaatggatgcctggctattgtcggaaggcacccacctgcgt
ccttatgaaacgctgggcgcgcacgccgatacgatggatggcgtcaccggcacccgtttc
tccgtctgggcgcctaatgctcgtcgcgtttcggttgtcgggcaattcaactattgggat
gggcgtcgccacccgatgcgtctgcgcaaagagagcggtatttgggagctgtttatcccc
ggcgcgcataatggacaactgtataaattcgagctgcttgatgcgaacggtaatctgcgc
attaaagccgatccctatgcttttgaggcgcagatgcgtccggaaacggcgtcgatgatt
tgcggactgccggagaaagtgacgccaggcgaagaacgacaaaaagccaatcagtttgat
gcgccgatctcgatttatgaggtgcatttaggttcatggcgccgccatacggataacaat
ttctggctgagctatcgtgagctggcggatcagcttgtgccttacgccaaatggatgggc
tttactcaccttgaactcttgccggtcaacgaacatccgtttgacggcagttggggctac
cagccgaccggcctctacgcgccgacccgccgctttggtacgcgagacgacttccgttat
ttcatcaatgcggcccatgcggcgggccttaacgtcattctcgactgggtgccgggccat
ttcccgtccgatgaatttagcctcgcggagtttgacggcacccacctctatgagcacagc
gacccgcgcgagggctatcaccaggactggaatacgctgatctacaactatggtcgtcgt
gaagtcagtaattatctggtgggtaacgccctgtactggatggagcgttttgggattgat
gcgctgcgtgtcgatgcggtggcctctatgatctaccgcgactacagccgcaaagagggc
gagtggataccgaacgagttcggcggtcgtgaaaacctggaagccattgagtttctgcgt
aataccaaccgcattattggcgagcaggtgcccggcgcggtcagcatggcggaagagtcg
acagacttctctggcgtgacgcgtccaccggaaacgggtgggctggggttctggtacaag
tggaatctgggctggatgcacgacacgctggactacatgaagctggacccggtgtaccgc
cagtatcatcacgacaagctgacctttggtatgttgtacaaccataccgaaaactttgtt
ctgccgctgtcgcacgatgaggtggttcacggcaagaaatccattctcgatcgtatgccg
ggcgatgcgtggcaaaaattcgccaacctgcgcgcctattatggttggatgtgggccttc
cccggcaagaaactgctgtttatggggaatgagtttgcccagggacgcgagtggaaccat
gacgccagcctcgactggcacctgctggaggggggcgataactggcaccacggggttcag
cgtctggtgcgcgatctcaaccacacctatcgccaccataaagcgttgcatgagctggat
tttgatgcttacggctttgagtggctggtggtcgatgacaatgaacgctcggtactgatt
tttgtacgccgtgataaagccggtaacgagatcatcgtcgccagcaactttacgcccgtt
cctcgccacgactaccgctttggcatcaaccagccgggacgctggcgtgaaattctcaat
actgattcgatgcattatcacggtagcaacaccggcaatggcggcgtggtgcacagcgat
gagatcgaaagccatggccgtcagcactctcttaacctgacgttaccgccgttggcgacg
atctggctgatgcgggagggggaatga

DBGET integrated database retrieval system