KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_04091Help
Entry
SU5_04091         CDS       T02011                                 

Definition
(GenBank) Endoglucanase precursor (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(4468517..4469626)
Genome map
AA seq 369 aa AA seqDB search
MMTMLRGWITMIVMLTAINAQAACSWPAWEQFKKDYISQQGRVIDPGDARKITTSEGQSY
AMFFALAANDRPAFAQLFNWTQNNLAQGSLREHLPAWLWGQKDPDTWSVLDSNSASDGDI
WMAWSLLEAGRLWKETRYTEVGTALLKRIAREEVVNVPGLGSMLLPGKIGFAEANSWRFN
PSYLPPQLAQYFSRFGAPWSTLRETNLRLLLETAPKGFSPDWVRYESKQGWQLKAEKTLI
SSYDAIRVYLWAGMMHDGDPQKARLLARFKPMATLTMKNGVPPEKVDVVSGNAQGTGPVG
FSAALLPFLQNRDAQAVQRQRVADHFPGSDAYYNYVLTLFGQGWDQHRFRFTVKGELLPD
WGQECVSSR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgactatgctgcgcggatggataacgatgatcgtcatgctgacggcaataaatgcg
caggcggcctgtagctggcctgcgtgggaacagttcaagaaagattacattagccagcag
ggacgcgttatcgatccgggcgatgcgcgaaaaattaccacctccgaagggcaaagctac
gccatgttctttgccctggcggcgaacgatcgaccggcgttcgcgcaactgtttaactgg
acgcaaaacaatctggcgcagggatcgctgcgtgaacatctgcccgcctggctgtgggga
caaaaagatcccgacacctggtcggtgctggacagcaactccgcgtccgacggcgatatc
tggatggcatggtcgctgctggaggccggtcgtctgtggaaagagacgcgttataccgag
gtgggtacggcgttgctaaaacgcatcgcccgcgaagaggtcgtgaatgtgccggggctg
ggctcaatgctgctacctggcaaaatcggctttgccgaggcgaatagctggcgttttaac
ccaagctatctgccgccgcagttggcgcaatactttagccgttttggcgcgccgtggtcg
acgttacgggaaaccaatttgcggcttttgctggaaaccgcgccgaaaggtttctcgccg
gactgggtgcgttatgaaagcaagcaaggctggcagttgaaagcggaaaagacgctgatc
agtagctacgatgcgattcgcgtctatttatgggcgggaatgatgcatgatggcgatccg
caaaaagcgcgtttactggcgcgatttaaaccgatggcgacgttaacgatgaaaaacggc
gttccaccggagaaagtggatgtcgtcagcgggaatgcgcaagggacggggccggtcggg
ttttccgccgccttactgcctttcctgcaaaatcgcgacgcccaggccgtgcagcgacag
cgggtcgcagaccattttcctggcagcgatgcctattacaactatgtgctgactctcttt
ggacaaggctgggatcagcaccgttttcgcttcaccgtcaaaggtgaattattacctgac
tggggccaggaatgcgtaagttcacgttaa

DBGET integrated database retrieval system