KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_04217Help
Entry
SU5_04217         CDS       T02011                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00230  Purine metabolism
shb01100  Metabolic pathways
Module
shb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SU5_04217
Enzymes [BR:shb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SU5_04217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase AAA_16 AAA_33 MMR_HSR1 AAA_22 ABC_tran AAA_18 Viral_helicase1 AAA_29
Motif
Other DBs
NCBI-ProteinID: AFH47535
Position
4604091..4604714
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRAPRPGEVHGEHYFFVNHD
EFKTMIGREAFLEHAEVFGNYYGTSRETIEQVLATGVDVFLDIDWQGAQQIREKMPQARS
IFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALSDLK
TIIRAERLRMSRQKQRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggtacgctttatattgtttctgcccccagtggtgcgggtaaatccagcctg
attcaggctttattaaaaacccaaccgttgtatgacactcaggtttccgtttcacatacc
acgcgcgcgccgcgtccgggtgaagtgcacggtgagcactatttctttgtaaatcatgat
gagtttaaaaccatgattggcagggaggcgtttctggagcacgcggaagtgtttggcaat
tactacggcacttcgcgcgaaaccattgagcaagtgctggcaaccggcgttgatgttttt
ctggatatcgactggcagggcgcccagcaaattcgcgaaaagatgccgcaagcacgcagc
atttttattttgccgccgtcaaagatcgaattggatcgccgtttacgcggccgcgggcaa
gatagcgaagaagtcattgccaaacgaatggcgcaagcggttgcagaaatgagccattac
gccgaatatgattatcttattgtgaatgacgactttgataccgcgttaagcgacttgaaa
accatcattcgcgctgaacgtctgcgtatgagccgccaaaagcagcgtcatgacgcttta
atcagcaaattgttggcagactga

DBGET integrated database retrieval system