KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0473Help
Entry
SU5_0473          CDS       T02011                                 

Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SU5_0473
Enzymes [BR:shb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SU5_0473
Transfer RNA biogenesis [BR:shb03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SU5_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
542808..543548
Genome map
AA seq 246 aa AA seqDB search
MLEQVCQLARNAGDAIMQVYDGAKPMEYARKQDDSPVTAADIAAHTVILEGLRTLTPDIP
VLSEEDPPAWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEQGKPVLGVVYAPVL
KVMYYAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHTDDELTEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTSVWDTAAGHAIAVAAGAHVHDWQGKTLDYTPRESFLNPG
FRVTIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagtatgccagcttgcacggaacgcgggcgatgccattatgcaggtttat
gatggagccaaaccgatggagtacgcccgcaagcaggacgattctccagtcactgcggcg
gatatcgccgcacataccgtgattctcgaagggttacgcacgctcacgccggatattccg
gtgctttcagaagaagatccgcccgcctgggaagtgcgccagcactggcagcgctactgg
ctggtcgatccgctcgacggcaccaaagagttcatcaagcgcaatggcgaattcacggtc
aatattgcgctgattgagcagggcaagccggtgttgggcgttgtctatgcgccggtgctg
aaagtgatgtactacgcggcggaaggtaaggcctggaaagaggagtgcggggtgcgtaag
cagattcaggtgcgggatgcccgcccgccgctggtggtgattagccgttcgcatacggat
gatgaactcaccgaatatctccaacagcttggcgaacatcagaccacctctattggttcc
tcgctgaaattctgtcttgtggcggaaggccaggcgcagctttaccccagatttgggccg
accagcgtctgggacactgccgcaggtcatgccattgctgttgcagccggggcgcacgtt
cacgactggcagggaaaaacgctggactatacccctcgtgagtcgttccttaaccccggc
ttccgggtgactatttactga

DBGET integrated database retrieval system