KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_049Help
Entry
SU5_049           CDS       T02011                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SU5_049
Enzymes [BR:shb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SU5_049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(60567..61307)
Genome map
AA seq 246 aa AA seqDB search
MSILITRPSPAGEALVSRLRALGQVAWSFPLIEFVAGRELPTLADRLATLTKNDLVFALS
QHAVAFAHAQLQRDGRHWPASPRYFAIGRTTALALHTVSGFDIRYPLDREISEALLQLPE
LQNIAGKRALILRGNGGRELLGETLTARGAEVSFCECYQRCAKHYDGAEEAMRWHTRGVT
TLVVTSGEMLQRLWSLTPEWYREHWLLRCRLLVVSERLAHLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctgatcacccgcccctctcccgcaggggaagcgttagtgagccgtctgcgc
gcactggggcaggtggcctggagttttccactgattgaatttgtcgccggccgggagcta
cccaccctggccgaccgcctggcgacgctgacgaaaaacgatctggtttttgccctttca
cagcacgccgtcgcctttgctcacgcccagctccagcgggatggccgacactggcctgcg
tcgccgcgctatttcgcgattggccgcaccacggcgctcgcccttcataccgttagcggg
ttcgatattcgttatccattggatcgggaaatcagcgaagccttgctacaattacctgaa
ttacaaaatattgcgggcaaacgcgcgctgattttgcgtggcaatggcggccgcgaactg
ctgggcgaaaccctgacagctcgcggagccgaagtcagtttttgtgaatgttatcaacga
tgtgcgaaacattacgatggcgcggaagaagcgatgcgctggcatactcgcggcgtaaca
acgcttgttgttaccagcggcgagatgttgcaacggctctggtcgctgactcccgagtgg
tatcgtgagcactggttactacgctgtcggctattggtcgtcagtgaacgtctggcgcac
cttgcccgggagctgggctggcaagatattaaggtcgctgataacgccgacaacgatgcg
ctgttgcgcgcattacaataa

DBGET integrated database retrieval system