KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_066Help
Entry
SU5_066           CDS       T02011                                 

Definition
Outer membrane phospholipase A (EC:3.1.1.32 3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SU5_066
   00565 Ether lipid metabolism
    SU5_066
   00590 Arachidonic acid metabolism
    SU5_066
   00591 Linoleic acid metabolism
    SU5_066
   00592 alpha-Linolenic acid metabolism
    SU5_066
Enzymes [BR:shb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     SU5_066
    3.1.1.32  phospholipase A1
     SU5_066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
76324..77193
Genome map
AA seq 289 aa AA seqDB search
MRAILRGLLPATLLPLAAYAQEATIKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTNTSDLNKEAISTYNWSENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSKESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVIGSTDDNPDITKYMGYYQLKIGYHLGEAVLSAKGQYNWNTGY
GGAEVGLSYPVTKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDIF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgattttgagagggttgttgccagccacgctactgccattagcggcatatgca
caagaagctacgataaaagaggttcatgatgcgcctgcagtacggggaagtatcatcgct
aacatgctacaggagcatgataacccttttacgctttacccttatgacacgaactacttg
atctacacgaacaccagcgatctgaacaaagaggccataagtacctacaactggtctgaa
aacgcacgtaaagatgaagtgaaatttcagttgagcctggcgtttccgctgtggcgcgga
atactggggccgaactcggtactgggcgcttcctatacgcagaaatcctggtggcagctt
tccaacagtaaagagtcttcgccgtttcgcgaaaccaactacgaaccgcagctttttctt
ggttttgctaccgattatcgctttgccggctggacgctgcgcgacgtagagatgggctac
aaccatgactctaacggacgttcggaccccacctcgcgtagctggaaccgtctgtatacc
cgtctgatggccgaaaacggtaactggctggtagaggtcaaaccgtggtacgtgattggc
agtaccgatgataatccggacatcaccaaatatatgggttattaccagcttaaaatcggt
tatcacctgggcgaggcggtattaagcgccaaaggccagtacaactggaatacaggctac
ggcggcgcggaagttggattaagctatccggtcactaaacatgtccggctttatacccag
gtgtacagcggctatggcgaatcgctgatcgactataattttaatcagacacgtgtcggc
gtcggcgtgatgcttaacgatatcttctga

DBGET integrated database retrieval system