KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0721Help
Entry
SU5_0721          CDS       T02011                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:shb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:shb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
830907..831386
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRHTWESIGRPLPGRKNI
VISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcggcgttagcggtggatcgcgtcatcggtatggaaaacgccatg
ccgtggaacctgcctgccgatctcgcctggtttaaacgtaacacgttaaataaacctgtc
gtcatgggacgtcacacctgggagtccatcgggcgccccttaccgggacgtaaaaatatt
gttatcagcagccagccgggcaccgacgatcgcgtgcagtgggtgaagtctgtcgatgag
gcgattgccgcttgcggcgatgcgccggaaattatggttattggcggcgggcgcgtgtac
gagcagttcctgccaaaggcgcagaagctttatctgacgcatattgatgcggaagtcgaa
ggcgatacccattttccggattatgaaccggatgactgggaatcggtattcagtgagttt
cacgatgccgacgcgcagaattctcacagctattgtttcgagattctggaacgtcgttaa

DBGET integrated database retrieval system